Spaces:
Running
on
L4
Running
on
L4
File size: 2,076 Bytes
bebad14 dffaf30 bebad14 28cb117 4853a01 bebad14 fd32c9f bebad14 28cb117 bebad14 f624b87 bebad14 fd32c9f f354223 bebad14 28cb117 bebad14 44470f9 28cb117 fd32c9f 28cb117 fd32c9f 28cb117 4853a01 fd32c9f 4853a01 28cb117 4853a01 28cb117 bebad14 fd32c9f dffaf30 bebad14 |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 |
import time
import gradio as gr
from gradio_molecule3d import Molecule3D
def predict (input_sequence, input_ligand, input_protein):
start_time = time.time()
# Do inference here
# return an output pdb file with the protein and two chains A and B.
end_time = time.time()
run_time = end_time - start_time
return "test_out.pdb", run_time
with gr.Blocks() as app:
gr.Markdown("# Template for inference")
gr.Markdown("Title, description, and other information about the model")
with gr.Row():
with gr.Column():
input_seq_1 = gr.Textbox(lines=3, label="Input Protein 1 sequence (FASTA)")
input_protein_1 = gr.File(label="Input Protein 2 monomer (PDB)")
with gr.Column():
input_seq_2 = gr.Textbox(lines=3, label="Input Protein 1 sequence (FASTA)")
input_protein_2 = gr.File(label="Input Protein 2 structure (PDB)")
# define any options here
# for automated inference the default options are used
# slider_option = gr.Slider(0,10, label="Slider Option")
# checkbox_option = gr.Checkbox(label="Checkbox Option")
# dropdown_option = gr.Dropdown(["Option 1", "Option 2", "Option 3"], label="Radio Option")
btn = gr.Button("Run Inference")
gr.Examples(
[
[
"GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD",
"3v1c_A.pdb",
"GSGSPLAQQIKNIHSFIHQAKAAGRMDEVRTLQENLHQLMHEYFQQSD",
"3v1c_B.pdb",
],
],
[input_sequence, input_ligand],
)
reps = [
{
"model": 0,
"style": "cartoon",
"chain": "A",
"color": "whiteCarbon",
},
{
"model": 0,
"chain": "B",
"style": "stick",
"color": "greenCarbon",
}
]
out = Molecule3D(reps=reps)
run_time = gr.Textbox(label="Runtime")
btn.click(predict, inputs=[input_seq_1, input_protein_1, input_seq_2, input_protein_2], outputs=[out, run_time])
app.launch()
|