Spaces:
Sleeping
Sleeping
Commit
·
2d87de0
1
Parent(s):
665cc97
feat: enhance app.py with session state management and extraction strategy selection
Browse files- Added initialization of session state for field descriptions and unique indices tables to improve user experience.
- Implemented a strategy selection feature allowing users to choose between "Original Strategy" and "Unique Indices Strategy" for data extraction.
- Updated the configuration section to load and save configurations, enhancing flexibility in managing extraction settings.
- Improved logging and error handling throughout the extraction process for better monitoring and debugging.
- logs/di_content/di_content_20250618_134751_tables.html +382 -0
- logs/di_content/di_content_20250618_135405_tables.html +382 -0
- logs/di_content/di_content_20250618_142043_tables.html +382 -0
- logs/di_content/di_content_20250618_142701_tables.html +1441 -0
- logs/di_content/di_content_20250618_143852_tables.html +1441 -0
- src/agents/__pycache__/field_mapper_agent.cpython-312.pyc +0 -0
- src/app.py +483 -338
- src/config/config_manager.py +148 -0
- src/config/file_types.yaml +170 -0
- src/config/settings.py +1 -1
- src/orchestrator/__pycache__/planner.cpython-312.pyc +0 -0
- src/services/__pycache__/llm_client.cpython-312.pyc +0 -0
logs/di_content/di_content_20250618_134751_tables.html
ADDED
@@ -0,0 +1,382 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
1 |
+
<!DOCTYPE html>
|
2 |
+
<html>
|
3 |
+
<head>
|
4 |
+
<title>Azure DI Tables</title>
|
5 |
+
<style>
|
6 |
+
body { font-family: Arial, sans-serif; margin: 20px; }
|
7 |
+
.table-container { margin-bottom: 40px; }
|
8 |
+
h2 { color: #333; }
|
9 |
+
table { border-collapse: collapse; width: 100%; margin-bottom: 10px; }
|
10 |
+
th, td { border: 1px solid #ddd; padding: 8px; text-align: left; }
|
11 |
+
th { background-color: #f5f5f5; }
|
12 |
+
hr { border: none; border-top: 2px solid #ccc; margin: 20px 0; }
|
13 |
+
</style>
|
14 |
+
</head>
|
15 |
+
<body>
|
16 |
+
<h1>Azure Document Intelligence Tables</h1>
|
17 |
+
|
18 |
+
<div class="table-container">
|
19 |
+
<h2>Table 1</h2>
|
20 |
+
<table border="1">
|
21 |
+
<tr>
|
22 |
+
<td>Account # 0800011357</td>
|
23 |
+
<td>Billing reference LBT/PI/2025/481; BRU354089 (6300005106)</td>
|
24 |
+
<td>Billing reference LBT/PI/2025/481; BRU354089 (6300005106)</td>
|
25 |
+
<td>Rec'd by WC (name) MIN-2</td>
|
26 |
+
<td>Rec'd by WC (name) MIN-2</td>
|
27 |
+
</tr>
|
28 |
+
<tr>
|
29 |
+
<td>From (Shipper)</td>
|
30 |
+
<td>From (Shipper)</td>
|
31 |
+
<td>To (Consignee)</td>
|
32 |
+
<td>To (Consignee)</td>
|
33 |
+
<td>To (Consignee)</td>
|
34 |
+
</tr>
|
35 |
+
<tr>
|
36 |
+
<td>Lim Ngian Gin/Jesline Ang</td>
|
37 |
+
<td>+6565213671/+65213959</td>
|
38 |
+
<td>Michelle de Meyer</td>
|
39 |
+
<td>+32 9 310 34 00</td>
|
40 |
+
<td>+32 9 310 34 00</td>
|
41 |
+
</tr>
|
42 |
+
<tr>
|
43 |
+
<td>LONZA BIOLOGICS TUAS PTE LTD</td>
|
44 |
+
<td></td>
|
45 |
+
<td>ARGENX BV</td>
|
46 |
+
<td></td>
|
47 |
+
<td></td>
|
48 |
+
</tr>
|
49 |
+
<tr>
|
50 |
+
<td>35 TUAS SOUTH AVE 6</td>
|
51 |
+
<td></td>
|
52 |
+
<td>INDUSTRIEPARK ZWIJNAARDE 7</td>
|
53 |
+
<td></td>
|
54 |
+
<td></td>
|
55 |
+
</tr>
|
56 |
+
<tr>
|
57 |
+
<td>TUAS 637377 SG</td>
|
58 |
+
<td></td>
|
59 |
+
<td>ZWIJNAARDE 9052 BE</td>
|
60 |
+
<td></td>
|
61 |
+
<td></td>
|
62 |
+
</tr>
|
63 |
+
<tr>
|
64 |
+
<td>Shipment information</td>
|
65 |
+
<td></td>
|
66 |
+
<td></td>
|
67 |
+
<td></td>
|
68 |
+
<td></td>
|
69 |
+
</tr>
|
70 |
+
<tr>
|
71 |
+
<td>Full description of contents</td>
|
72 |
+
<td></td>
|
73 |
+
<td>Special handling</td>
|
74 |
+
<td></td>
|
75 |
+
<td></td>
|
76 |
+
</tr>
|
77 |
+
<tr>
|
78 |
+
<td>PROTEIN SAMPLES, Deep Frozen Dry Ice -70C [+/-10C]</td>
|
79 |
+
<td>PROTEIN SAMPLES, Deep Frozen Dry Ice -70C [+/-10C]</td>
|
80 |
+
<td></td>
|
81 |
+
<td></td>
|
82 |
+
<td></td>
|
83 |
+
</tr>
|
84 |
+
</table>
|
85 |
+
<hr>
|
86 |
+
</div>
|
87 |
+
|
88 |
+
<div class="table-container">
|
89 |
+
<h2>Table 2</h2>
|
90 |
+
<table border="1">
|
91 |
+
<tr>
|
92 |
+
<td>Number of pieces</td>
|
93 |
+
<td>:unselected: Weight LBS</td>
|
94 |
+
<td>Dimensions</td>
|
95 |
+
<td>:selected: CM</td>
|
96 |
+
<td>Does this shipment contain dangerous goods?</td>
|
97 |
+
<td>Does this shipment contain dangerous goods?</td>
|
98 |
+
<td></td>
|
99 |
+
</tr>
|
100 |
+
<tr>
|
101 |
+
<td>1</td>
|
102 |
+
<td>:selected: 22 KGS</td>
|
103 |
+
<td>53 X 36 X 44</td>
|
104 |
+
<td>:unselected: IN</td>
|
105 |
+
<td>:unselected: NO</td>
|
106 |
+
<td>:unselected: YES (Per attached shipper's declaration)</td>
|
107 |
+
<td>:selected:
|
108 |
+
YES (Shipper's declaration not required)</td>
|
109 |
+
</tr>
|
110 |
+
</table>
|
111 |
+
<hr>
|
112 |
+
</div>
|
113 |
+
|
114 |
+
<div class="table-container">
|
115 |
+
<h2>Table 3</h2>
|
116 |
+
<table border="1">
|
117 |
+
<tr>
|
118 |
+
<td>Country of origin</td>
|
119 |
+
<td>Declared value for customs</td>
|
120 |
+
<td>Declared value for carriage Check if surcharge elected</td>
|
121 |
+
</tr>
|
122 |
+
<tr>
|
123 |
+
<td></td>
|
124 |
+
<td>10.00 USD</td>
|
125 |
+
<td>:unselected:</td>
|
126 |
+
</tr>
|
127 |
+
</table>
|
128 |
+
<hr>
|
129 |
+
</div>
|
130 |
+
|
131 |
+
<div class="table-container">
|
132 |
+
<h2>Table 4</h2>
|
133 |
+
<table border="1">
|
134 |
+
<tr>
|
135 |
+
<td>Print name of shipper or shipper's agent Jesline Ang</td>
|
136 |
+
<td>Date 19 Mag25</td>
|
137 |
+
<td>Print name of consignee or consignee's agent Gavein Vanden Albeck</td>
|
138 |
+
<td>Date</td>
|
139 |
+
</tr>
|
140 |
+
<tr>
|
141 |
+
<td>Print name of shipper or shipper's agent Jesline Ang</td>
|
142 |
+
<td>Date 19 Mag25</td>
|
143 |
+
<td>Print name of consignee or consignee's agent Gavein Vanden Albeck</td>
|
144 |
+
<td>27/05/2025</td>
|
145 |
+
</tr>
|
146 |
+
<tr>
|
147 |
+
<td>Signature of shipper or shipper's agent
|
148 |
+
:selected:</td>
|
149 |
+
<td>Time</td>
|
150 |
+
<td>Signature of consignee or consignee's agent</td>
|
151 |
+
<td>Time</td>
|
152 |
+
</tr>
|
153 |
+
<tr>
|
154 |
+
<td>$
|
155 |
+
:selected:</td>
|
156 |
+
<td>1230</td>
|
157 |
+
<td>Estudia</td>
|
158 |
+
<td>gu 25</td>
|
159 |
+
</tr>
|
160 |
+
</table>
|
161 |
+
<hr>
|
162 |
+
</div>
|
163 |
+
|
164 |
+
<div class="table-container">
|
165 |
+
<h2>Table 5</h2>
|
166 |
+
<table border="1">
|
167 |
+
<tr>
|
168 |
+
<td>Company Reg. No</td>
|
169 |
+
<td>:200614708M</td>
|
170 |
+
</tr>
|
171 |
+
<tr>
|
172 |
+
<td>MGST Reg. No.</td>
|
173 |
+
<td>:20-0614708-M</td>
|
174 |
+
</tr>
|
175 |
+
</table>
|
176 |
+
<hr>
|
177 |
+
</div>
|
178 |
+
|
179 |
+
<div class="table-container">
|
180 |
+
<h2>Table 6</h2>
|
181 |
+
<table border="1">
|
182 |
+
<tr>
|
183 |
+
<td>Shipping Invoice no:</td>
|
184 |
+
<td>LBT/PI/2025/481</td>
|
185 |
+
</tr>
|
186 |
+
<tr>
|
187 |
+
<td>Dated:</td>
|
188 |
+
<td>5/19/2025</td>
|
189 |
+
</tr>
|
190 |
+
</table>
|
191 |
+
<hr>
|
192 |
+
</div>
|
193 |
+
|
194 |
+
<div class="table-container">
|
195 |
+
<h2>Table 7</h2>
|
196 |
+
<table border="1">
|
197 |
+
<tr>
|
198 |
+
<td>Contact Person :</td>
|
199 |
+
<td>Lim Ngian Gin/Jesline Ang</td>
|
200 |
+
</tr>
|
201 |
+
<tr>
|
202 |
+
<td>Telephone:</td>
|
203 |
+
<td>+6565213671/+65213959</td>
|
204 |
+
</tr>
|
205 |
+
<tr>
|
206 |
+
<td>Email:</td>
|
207 |
+
<td>[email protected]</td>
|
208 |
+
</tr>
|
209 |
+
<tr>
|
210 |
+
<td>Freight charges</td>
|
211 |
+
<td>WC acct # 354089 (6300005106)</td>
|
212 |
+
</tr>
|
213 |
+
</table>
|
214 |
+
<hr>
|
215 |
+
</div>
|
216 |
+
|
217 |
+
<div class="table-container">
|
218 |
+
<h2>Table 8</h2>
|
219 |
+
<table border="1">
|
220 |
+
<tr>
|
221 |
+
<td>Contact Person :</td>
|
222 |
+
<td>Michelle de Meyer</td>
|
223 |
+
</tr>
|
224 |
+
<tr>
|
225 |
+
<td>Telephone:</td>
|
226 |
+
<td>+32 9 310 34 00</td>
|
227 |
+
</tr>
|
228 |
+
<tr>
|
229 |
+
<td>Email:</td>
|
230 |
+
<td>[email protected]</td>
|
231 |
+
</tr>
|
232 |
+
</table>
|
233 |
+
<hr>
|
234 |
+
</div>
|
235 |
+
|
236 |
+
<div class="table-container">
|
237 |
+
<h2>Table 9</h2>
|
238 |
+
<table border="1">
|
239 |
+
<tr>
|
240 |
+
<td>Shipper's Reference:</td>
|
241 |
+
<td>LBT/PI/2025/481</td>
|
242 |
+
</tr>
|
243 |
+
<tr>
|
244 |
+
<td>Shipping Terms:</td>
|
245 |
+
<td>Ex work</td>
|
246 |
+
</tr>
|
247 |
+
<tr>
|
248 |
+
<td>Dimension of Box (LXWXH)</td>
|
249 |
+
<td>E89 (53x35.5x44cm)</td>
|
250 |
+
</tr>
|
251 |
+
<tr>
|
252 |
+
<td>Gross Weight:</td>
|
253 |
+
<td>22 KG</td>
|
254 |
+
</tr>
|
255 |
+
<tr>
|
256 |
+
<td>No of Boxes:</td>
|
257 |
+
<td>1</td>
|
258 |
+
</tr>
|
259 |
+
<tr>
|
260 |
+
<td>Country of Origin:</td>
|
261 |
+
<td>Singapore</td>
|
262 |
+
</tr>
|
263 |
+
</table>
|
264 |
+
<hr>
|
265 |
+
</div>
|
266 |
+
|
267 |
+
<div class="table-container">
|
268 |
+
<h2>Table 10</h2>
|
269 |
+
<table border="1">
|
270 |
+
<tr>
|
271 |
+
<td>HAWB:</td>
|
272 |
+
<td>716450106</td>
|
273 |
+
</tr>
|
274 |
+
<tr>
|
275 |
+
<td>Shipment condition:</td>
|
276 |
+
<td>Dry ice</td>
|
277 |
+
</tr>
|
278 |
+
<tr>
|
279 |
+
<td>NET WT:</td>
|
280 |
+
<td>20 KG</td>
|
281 |
+
</tr>
|
282 |
+
</table>
|
283 |
+
<hr>
|
284 |
+
</div>
|
285 |
+
|
286 |
+
<div class="table-container">
|
287 |
+
<h2>Table 11</h2>
|
288 |
+
<table border="1">
|
289 |
+
<tr>
|
290 |
+
<td>Description of Goods</td>
|
291 |
+
<td>Quantity</td>
|
292 |
+
<td>Value of Goods</td>
|
293 |
+
</tr>
|
294 |
+
<tr>
|
295 |
+
<td>3060 Stability Timepoint Sample, T=12M Lot Number - 1233490 HS Code : 3002.00.00</td>
|
296 |
+
<td>4 x 2mL</td>
|
297 |
+
<td>10</td>
|
298 |
+
</tr>
|
299 |
+
<tr>
|
300 |
+
<td>Origin: CHO Genus/Species: Cricetulus Griseus The samples are mixture of highly purified Protien samples and Cell Culture fluids. The intended use of these samples is for laboratory analysis only. Material is recombinant, but contains no genes or expresses no products of exotic livestock or poultry disease agents. These samples do not come from a facility where work with exotic viruses affecting livestock and avian species is conducted .. The product was highly purified to remove all cell material, DNA and animal substances. The samples do not contain any active pharmaceutical/drug</td>
|
301 |
+
<td></td>
|
302 |
+
<td></td>
|
303 |
+
</tr>
|
304 |
+
</table>
|
305 |
+
<hr>
|
306 |
+
</div>
|
307 |
+
|
308 |
+
<div class="table-container">
|
309 |
+
<h2>Table 12</h2>
|
310 |
+
<table border="1">
|
311 |
+
<tr>
|
312 |
+
<td>Customer Code</td>
|
313 |
+
<td>Stability Protocol</td>
|
314 |
+
<td>Lot #</td>
|
315 |
+
<td>Storage Condition</td>
|
316 |
+
<td>Timepoint</td>
|
317 |
+
<td>Test</td>
|
318 |
+
<td>Aliquot Volume</td>
|
319 |
+
<td>Aliquot Container</td>
|
320 |
+
<td>Shipping Temperature (deg C)</td>
|
321 |
+
<td>LIMS ID</td>
|
322 |
+
<td></td>
|
323 |
+
</tr>
|
324 |
+
<tr>
|
325 |
+
<td>3060</td>
|
326 |
+
<td>SGTS-34842</td>
|
327 |
+
<td>1233490</td>
|
328 |
+
<td>-70 deg C</td>
|
329 |
+
<td>T=12M</td>
|
330 |
+
<td>N/A (Customer Sample)</td>
|
331 |
+
<td>:selected: 1 x 2mL</td>
|
332 |
+
<td>PP Tube</td>
|
333 |
+
<td>≤-65</td>
|
334 |
+
<td>1 BA- :selected:</td>
|
335 |
+
<td>2244197</td>
|
336 |
+
</tr>
|
337 |
+
<tr>
|
338 |
+
<td>3060</td>
|
339 |
+
<td>SGTS-34842</td>
|
340 |
+
<td>1233490</td>
|
341 |
+
<td>-40 deg C</td>
|
342 |
+
<td>T=12M</td>
|
343 |
+
<td>N/A (Customer Sample)</td>
|
344 |
+
<td>:selected: 1 x 2mL
|
345 |
+
Y</td>
|
346 |
+
<td>PP Tube</td>
|
347 |
+
<td>≤-65</td>
|
348 |
+
<td>1 FBA-
|
349 |
+
:selected:</td>
|
350 |
+
<td>2244196</td>
|
351 |
+
</tr>
|
352 |
+
<tr>
|
353 |
+
<td>3060</td>
|
354 |
+
<td>SGTS-34842</td>
|
355 |
+
<td>1233490</td>
|
356 |
+
<td>+25 deg C</td>
|
357 |
+
<td>T=12M</td>
|
358 |
+
<td>N/A (Customer Sample)</td>
|
359 |
+
<td>4
|
360 |
+
:selected: 1 x 2mL</td>
|
361 |
+
<td>PP Tube</td>
|
362 |
+
<td>≤-65</td>
|
363 |
+
<td>1 TBA- :selected:</td>
|
364 |
+
<td>2244199</td>
|
365 |
+
</tr>
|
366 |
+
<tr>
|
367 |
+
<td>3060</td>
|
368 |
+
<td>SGTS-34842</td>
|
369 |
+
<td>1233490</td>
|
370 |
+
<td>+5 deg C</td>
|
371 |
+
<td>T=12M</td>
|
372 |
+
<td>N/A (Customer Sample)</td>
|
373 |
+
<td>:selected: 1 x 2mL V</td>
|
374 |
+
<td>PP Tube</td>
|
375 |
+
<td>≤-65</td>
|
376 |
+
<td>TBA- :selected:</td>
|
377 |
+
<td>2244200</td>
|
378 |
+
</tr>
|
379 |
+
</table>
|
380 |
+
<hr>
|
381 |
+
</div>
|
382 |
+
</body></html>
|
logs/di_content/di_content_20250618_135405_tables.html
ADDED
@@ -0,0 +1,382 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
1 |
+
<!DOCTYPE html>
|
2 |
+
<html>
|
3 |
+
<head>
|
4 |
+
<title>Azure DI Tables</title>
|
5 |
+
<style>
|
6 |
+
body { font-family: Arial, sans-serif; margin: 20px; }
|
7 |
+
.table-container { margin-bottom: 40px; }
|
8 |
+
h2 { color: #333; }
|
9 |
+
table { border-collapse: collapse; width: 100%; margin-bottom: 10px; }
|
10 |
+
th, td { border: 1px solid #ddd; padding: 8px; text-align: left; }
|
11 |
+
th { background-color: #f5f5f5; }
|
12 |
+
hr { border: none; border-top: 2px solid #ccc; margin: 20px 0; }
|
13 |
+
</style>
|
14 |
+
</head>
|
15 |
+
<body>
|
16 |
+
<h1>Azure Document Intelligence Tables</h1>
|
17 |
+
|
18 |
+
<div class="table-container">
|
19 |
+
<h2>Table 1</h2>
|
20 |
+
<table border="1">
|
21 |
+
<tr>
|
22 |
+
<td>Account # 0800011357</td>
|
23 |
+
<td>Billing reference LBT/PI/2025/481; BRU354089 (6300005106)</td>
|
24 |
+
<td>Billing reference LBT/PI/2025/481; BRU354089 (6300005106)</td>
|
25 |
+
<td>Rec'd by WC (name) MIN-2</td>
|
26 |
+
<td>Rec'd by WC (name) MIN-2</td>
|
27 |
+
</tr>
|
28 |
+
<tr>
|
29 |
+
<td>From (Shipper)</td>
|
30 |
+
<td>From (Shipper)</td>
|
31 |
+
<td>To (Consignee)</td>
|
32 |
+
<td>To (Consignee)</td>
|
33 |
+
<td>To (Consignee)</td>
|
34 |
+
</tr>
|
35 |
+
<tr>
|
36 |
+
<td>Lim Ngian Gin/Jesline Ang</td>
|
37 |
+
<td>+6565213671/+65213959</td>
|
38 |
+
<td>Michelle de Meyer</td>
|
39 |
+
<td>+32 9 310 34 00</td>
|
40 |
+
<td>+32 9 310 34 00</td>
|
41 |
+
</tr>
|
42 |
+
<tr>
|
43 |
+
<td>LONZA BIOLOGICS TUAS PTE LTD</td>
|
44 |
+
<td></td>
|
45 |
+
<td>ARGENX BV</td>
|
46 |
+
<td></td>
|
47 |
+
<td></td>
|
48 |
+
</tr>
|
49 |
+
<tr>
|
50 |
+
<td>35 TUAS SOUTH AVE 6</td>
|
51 |
+
<td></td>
|
52 |
+
<td>INDUSTRIEPARK ZWIJNAARDE 7</td>
|
53 |
+
<td></td>
|
54 |
+
<td></td>
|
55 |
+
</tr>
|
56 |
+
<tr>
|
57 |
+
<td>TUAS 637377 SG</td>
|
58 |
+
<td></td>
|
59 |
+
<td>ZWIJNAARDE 9052 BE</td>
|
60 |
+
<td></td>
|
61 |
+
<td></td>
|
62 |
+
</tr>
|
63 |
+
<tr>
|
64 |
+
<td>Shipment information</td>
|
65 |
+
<td></td>
|
66 |
+
<td></td>
|
67 |
+
<td></td>
|
68 |
+
<td></td>
|
69 |
+
</tr>
|
70 |
+
<tr>
|
71 |
+
<td>Full description of contents</td>
|
72 |
+
<td></td>
|
73 |
+
<td>Special handling</td>
|
74 |
+
<td></td>
|
75 |
+
<td></td>
|
76 |
+
</tr>
|
77 |
+
<tr>
|
78 |
+
<td>PROTEIN SAMPLES, Deep Frozen Dry Ice -70C [+/-10C]</td>
|
79 |
+
<td>PROTEIN SAMPLES, Deep Frozen Dry Ice -70C [+/-10C]</td>
|
80 |
+
<td></td>
|
81 |
+
<td></td>
|
82 |
+
<td></td>
|
83 |
+
</tr>
|
84 |
+
</table>
|
85 |
+
<hr>
|
86 |
+
</div>
|
87 |
+
|
88 |
+
<div class="table-container">
|
89 |
+
<h2>Table 2</h2>
|
90 |
+
<table border="1">
|
91 |
+
<tr>
|
92 |
+
<td>Number of pieces</td>
|
93 |
+
<td>:unselected: Weight LBS</td>
|
94 |
+
<td>Dimensions</td>
|
95 |
+
<td>:selected: CM</td>
|
96 |
+
<td>Does this shipment contain dangerous goods?</td>
|
97 |
+
<td>Does this shipment contain dangerous goods?</td>
|
98 |
+
<td></td>
|
99 |
+
</tr>
|
100 |
+
<tr>
|
101 |
+
<td>1</td>
|
102 |
+
<td>:selected: 22 KGS</td>
|
103 |
+
<td>53 X 36 X 44</td>
|
104 |
+
<td>:unselected: IN</td>
|
105 |
+
<td>:unselected: NO</td>
|
106 |
+
<td>:unselected: YES (Per attached shipper's declaration)</td>
|
107 |
+
<td>:selected:
|
108 |
+
YES (Shipper's declaration not required)</td>
|
109 |
+
</tr>
|
110 |
+
</table>
|
111 |
+
<hr>
|
112 |
+
</div>
|
113 |
+
|
114 |
+
<div class="table-container">
|
115 |
+
<h2>Table 3</h2>
|
116 |
+
<table border="1">
|
117 |
+
<tr>
|
118 |
+
<td>Country of origin</td>
|
119 |
+
<td>Declared value for customs</td>
|
120 |
+
<td>Declared value for carriage Check if surcharge elected</td>
|
121 |
+
</tr>
|
122 |
+
<tr>
|
123 |
+
<td></td>
|
124 |
+
<td>10.00 USD</td>
|
125 |
+
<td>:unselected:</td>
|
126 |
+
</tr>
|
127 |
+
</table>
|
128 |
+
<hr>
|
129 |
+
</div>
|
130 |
+
|
131 |
+
<div class="table-container">
|
132 |
+
<h2>Table 4</h2>
|
133 |
+
<table border="1">
|
134 |
+
<tr>
|
135 |
+
<td>Print name of shipper or shipper's agent Jesline Ang</td>
|
136 |
+
<td>Date 19 Mag25</td>
|
137 |
+
<td>Print name of consignee or consignee's agent Gavein Vanden Albeck</td>
|
138 |
+
<td>Date</td>
|
139 |
+
</tr>
|
140 |
+
<tr>
|
141 |
+
<td>Print name of shipper or shipper's agent Jesline Ang</td>
|
142 |
+
<td>Date 19 Mag25</td>
|
143 |
+
<td>Print name of consignee or consignee's agent Gavein Vanden Albeck</td>
|
144 |
+
<td>27/05/2025</td>
|
145 |
+
</tr>
|
146 |
+
<tr>
|
147 |
+
<td>Signature of shipper or shipper's agent
|
148 |
+
:selected:</td>
|
149 |
+
<td>Time</td>
|
150 |
+
<td>Signature of consignee or consignee's agent</td>
|
151 |
+
<td>Time</td>
|
152 |
+
</tr>
|
153 |
+
<tr>
|
154 |
+
<td>$
|
155 |
+
:selected:</td>
|
156 |
+
<td>1230</td>
|
157 |
+
<td>Estudia</td>
|
158 |
+
<td>gu 25</td>
|
159 |
+
</tr>
|
160 |
+
</table>
|
161 |
+
<hr>
|
162 |
+
</div>
|
163 |
+
|
164 |
+
<div class="table-container">
|
165 |
+
<h2>Table 5</h2>
|
166 |
+
<table border="1">
|
167 |
+
<tr>
|
168 |
+
<td>Company Reg. No</td>
|
169 |
+
<td>:200614708M</td>
|
170 |
+
</tr>
|
171 |
+
<tr>
|
172 |
+
<td>MGST Reg. No.</td>
|
173 |
+
<td>:20-0614708-M</td>
|
174 |
+
</tr>
|
175 |
+
</table>
|
176 |
+
<hr>
|
177 |
+
</div>
|
178 |
+
|
179 |
+
<div class="table-container">
|
180 |
+
<h2>Table 6</h2>
|
181 |
+
<table border="1">
|
182 |
+
<tr>
|
183 |
+
<td>Shipping Invoice no:</td>
|
184 |
+
<td>LBT/PI/2025/481</td>
|
185 |
+
</tr>
|
186 |
+
<tr>
|
187 |
+
<td>Dated:</td>
|
188 |
+
<td>5/19/2025</td>
|
189 |
+
</tr>
|
190 |
+
</table>
|
191 |
+
<hr>
|
192 |
+
</div>
|
193 |
+
|
194 |
+
<div class="table-container">
|
195 |
+
<h2>Table 7</h2>
|
196 |
+
<table border="1">
|
197 |
+
<tr>
|
198 |
+
<td>Contact Person :</td>
|
199 |
+
<td>Lim Ngian Gin/Jesline Ang</td>
|
200 |
+
</tr>
|
201 |
+
<tr>
|
202 |
+
<td>Telephone:</td>
|
203 |
+
<td>+6565213671/+65213959</td>
|
204 |
+
</tr>
|
205 |
+
<tr>
|
206 |
+
<td>Email:</td>
|
207 |
+
<td>[email protected]</td>
|
208 |
+
</tr>
|
209 |
+
<tr>
|
210 |
+
<td>Freight charges</td>
|
211 |
+
<td>WC acct # 354089 (6300005106)</td>
|
212 |
+
</tr>
|
213 |
+
</table>
|
214 |
+
<hr>
|
215 |
+
</div>
|
216 |
+
|
217 |
+
<div class="table-container">
|
218 |
+
<h2>Table 8</h2>
|
219 |
+
<table border="1">
|
220 |
+
<tr>
|
221 |
+
<td>Contact Person :</td>
|
222 |
+
<td>Michelle de Meyer</td>
|
223 |
+
</tr>
|
224 |
+
<tr>
|
225 |
+
<td>Telephone:</td>
|
226 |
+
<td>+32 9 310 34 00</td>
|
227 |
+
</tr>
|
228 |
+
<tr>
|
229 |
+
<td>Email:</td>
|
230 |
+
<td>[email protected]</td>
|
231 |
+
</tr>
|
232 |
+
</table>
|
233 |
+
<hr>
|
234 |
+
</div>
|
235 |
+
|
236 |
+
<div class="table-container">
|
237 |
+
<h2>Table 9</h2>
|
238 |
+
<table border="1">
|
239 |
+
<tr>
|
240 |
+
<td>Shipper's Reference:</td>
|
241 |
+
<td>LBT/PI/2025/481</td>
|
242 |
+
</tr>
|
243 |
+
<tr>
|
244 |
+
<td>Shipping Terms:</td>
|
245 |
+
<td>Ex work</td>
|
246 |
+
</tr>
|
247 |
+
<tr>
|
248 |
+
<td>Dimension of Box (LXWXH)</td>
|
249 |
+
<td>E89 (53x35.5x44cm)</td>
|
250 |
+
</tr>
|
251 |
+
<tr>
|
252 |
+
<td>Gross Weight:</td>
|
253 |
+
<td>22 KG</td>
|
254 |
+
</tr>
|
255 |
+
<tr>
|
256 |
+
<td>No of Boxes:</td>
|
257 |
+
<td>1</td>
|
258 |
+
</tr>
|
259 |
+
<tr>
|
260 |
+
<td>Country of Origin:</td>
|
261 |
+
<td>Singapore</td>
|
262 |
+
</tr>
|
263 |
+
</table>
|
264 |
+
<hr>
|
265 |
+
</div>
|
266 |
+
|
267 |
+
<div class="table-container">
|
268 |
+
<h2>Table 10</h2>
|
269 |
+
<table border="1">
|
270 |
+
<tr>
|
271 |
+
<td>HAWB:</td>
|
272 |
+
<td>716450106</td>
|
273 |
+
</tr>
|
274 |
+
<tr>
|
275 |
+
<td>Shipment condition:</td>
|
276 |
+
<td>Dry ice</td>
|
277 |
+
</tr>
|
278 |
+
<tr>
|
279 |
+
<td>NET WT:</td>
|
280 |
+
<td>20 KG</td>
|
281 |
+
</tr>
|
282 |
+
</table>
|
283 |
+
<hr>
|
284 |
+
</div>
|
285 |
+
|
286 |
+
<div class="table-container">
|
287 |
+
<h2>Table 11</h2>
|
288 |
+
<table border="1">
|
289 |
+
<tr>
|
290 |
+
<td>Description of Goods</td>
|
291 |
+
<td>Quantity</td>
|
292 |
+
<td>Value of Goods</td>
|
293 |
+
</tr>
|
294 |
+
<tr>
|
295 |
+
<td>3060 Stability Timepoint Sample, T=12M Lot Number - 1233490 HS Code : 3002.00.00</td>
|
296 |
+
<td>4 x 2mL</td>
|
297 |
+
<td>10</td>
|
298 |
+
</tr>
|
299 |
+
<tr>
|
300 |
+
<td>Origin: CHO Genus/Species: Cricetulus Griseus The samples are mixture of highly purified Protien samples and Cell Culture fluids. The intended use of these samples is for laboratory analysis only. Material is recombinant, but contains no genes or expresses no products of exotic livestock or poultry disease agents. These samples do not come from a facility where work with exotic viruses affecting livestock and avian species is conducted .. The product was highly purified to remove all cell material, DNA and animal substances. The samples do not contain any active pharmaceutical/drug</td>
|
301 |
+
<td></td>
|
302 |
+
<td></td>
|
303 |
+
</tr>
|
304 |
+
</table>
|
305 |
+
<hr>
|
306 |
+
</div>
|
307 |
+
|
308 |
+
<div class="table-container">
|
309 |
+
<h2>Table 12</h2>
|
310 |
+
<table border="1">
|
311 |
+
<tr>
|
312 |
+
<td>Customer Code</td>
|
313 |
+
<td>Stability Protocol</td>
|
314 |
+
<td>Lot #</td>
|
315 |
+
<td>Storage Condition</td>
|
316 |
+
<td>Timepoint</td>
|
317 |
+
<td>Test</td>
|
318 |
+
<td>Aliquot Volume</td>
|
319 |
+
<td>Aliquot Container</td>
|
320 |
+
<td>Shipping Temperature (deg C)</td>
|
321 |
+
<td>LIMS ID</td>
|
322 |
+
<td></td>
|
323 |
+
</tr>
|
324 |
+
<tr>
|
325 |
+
<td>3060</td>
|
326 |
+
<td>SGTS-34842</td>
|
327 |
+
<td>1233490</td>
|
328 |
+
<td>-70 deg C</td>
|
329 |
+
<td>T=12M</td>
|
330 |
+
<td>N/A (Customer Sample)</td>
|
331 |
+
<td>:selected: 1 x 2mL</td>
|
332 |
+
<td>PP Tube</td>
|
333 |
+
<td>≤-65</td>
|
334 |
+
<td>1 BA- :selected:</td>
|
335 |
+
<td>2244197</td>
|
336 |
+
</tr>
|
337 |
+
<tr>
|
338 |
+
<td>3060</td>
|
339 |
+
<td>SGTS-34842</td>
|
340 |
+
<td>1233490</td>
|
341 |
+
<td>-40 deg C</td>
|
342 |
+
<td>T=12M</td>
|
343 |
+
<td>N/A (Customer Sample)</td>
|
344 |
+
<td>:selected: 1 x 2mL
|
345 |
+
Y</td>
|
346 |
+
<td>PP Tube</td>
|
347 |
+
<td>≤-65</td>
|
348 |
+
<td>1 FBA-
|
349 |
+
:selected:</td>
|
350 |
+
<td>2244196</td>
|
351 |
+
</tr>
|
352 |
+
<tr>
|
353 |
+
<td>3060</td>
|
354 |
+
<td>SGTS-34842</td>
|
355 |
+
<td>1233490</td>
|
356 |
+
<td>+25 deg C</td>
|
357 |
+
<td>T=12M</td>
|
358 |
+
<td>N/A (Customer Sample)</td>
|
359 |
+
<td>4
|
360 |
+
:selected: 1 x 2mL</td>
|
361 |
+
<td>PP Tube</td>
|
362 |
+
<td>≤-65</td>
|
363 |
+
<td>1 TBA- :selected:</td>
|
364 |
+
<td>2244199</td>
|
365 |
+
</tr>
|
366 |
+
<tr>
|
367 |
+
<td>3060</td>
|
368 |
+
<td>SGTS-34842</td>
|
369 |
+
<td>1233490</td>
|
370 |
+
<td>+5 deg C</td>
|
371 |
+
<td>T=12M</td>
|
372 |
+
<td>N/A (Customer Sample)</td>
|
373 |
+
<td>:selected: 1 x 2mL V</td>
|
374 |
+
<td>PP Tube</td>
|
375 |
+
<td>≤-65</td>
|
376 |
+
<td>TBA- :selected:</td>
|
377 |
+
<td>2244200</td>
|
378 |
+
</tr>
|
379 |
+
</table>
|
380 |
+
<hr>
|
381 |
+
</div>
|
382 |
+
</body></html>
|
logs/di_content/di_content_20250618_142043_tables.html
ADDED
@@ -0,0 +1,382 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
1 |
+
<!DOCTYPE html>
|
2 |
+
<html>
|
3 |
+
<head>
|
4 |
+
<title>Azure DI Tables</title>
|
5 |
+
<style>
|
6 |
+
body { font-family: Arial, sans-serif; margin: 20px; }
|
7 |
+
.table-container { margin-bottom: 40px; }
|
8 |
+
h2 { color: #333; }
|
9 |
+
table { border-collapse: collapse; width: 100%; margin-bottom: 10px; }
|
10 |
+
th, td { border: 1px solid #ddd; padding: 8px; text-align: left; }
|
11 |
+
th { background-color: #f5f5f5; }
|
12 |
+
hr { border: none; border-top: 2px solid #ccc; margin: 20px 0; }
|
13 |
+
</style>
|
14 |
+
</head>
|
15 |
+
<body>
|
16 |
+
<h1>Azure Document Intelligence Tables</h1>
|
17 |
+
|
18 |
+
<div class="table-container">
|
19 |
+
<h2>Table 1</h2>
|
20 |
+
<table border="1">
|
21 |
+
<tr>
|
22 |
+
<td>Account # 0800011357</td>
|
23 |
+
<td>Billing reference LBT/PI/2025/481; BRU354089 (6300005106)</td>
|
24 |
+
<td>Billing reference LBT/PI/2025/481; BRU354089 (6300005106)</td>
|
25 |
+
<td>Rec'd by WC (name) MIN-2</td>
|
26 |
+
<td>Rec'd by WC (name) MIN-2</td>
|
27 |
+
</tr>
|
28 |
+
<tr>
|
29 |
+
<td>From (Shipper)</td>
|
30 |
+
<td>From (Shipper)</td>
|
31 |
+
<td>To (Consignee)</td>
|
32 |
+
<td>To (Consignee)</td>
|
33 |
+
<td>To (Consignee)</td>
|
34 |
+
</tr>
|
35 |
+
<tr>
|
36 |
+
<td>Lim Ngian Gin/Jesline Ang</td>
|
37 |
+
<td>+6565213671/+65213959</td>
|
38 |
+
<td>Michelle de Meyer</td>
|
39 |
+
<td>+32 9 310 34 00</td>
|
40 |
+
<td>+32 9 310 34 00</td>
|
41 |
+
</tr>
|
42 |
+
<tr>
|
43 |
+
<td>LONZA BIOLOGICS TUAS PTE LTD</td>
|
44 |
+
<td></td>
|
45 |
+
<td>ARGENX BV</td>
|
46 |
+
<td></td>
|
47 |
+
<td></td>
|
48 |
+
</tr>
|
49 |
+
<tr>
|
50 |
+
<td>35 TUAS SOUTH AVE 6</td>
|
51 |
+
<td></td>
|
52 |
+
<td>INDUSTRIEPARK ZWIJNAARDE 7</td>
|
53 |
+
<td></td>
|
54 |
+
<td></td>
|
55 |
+
</tr>
|
56 |
+
<tr>
|
57 |
+
<td>TUAS 637377 SG</td>
|
58 |
+
<td></td>
|
59 |
+
<td>ZWIJNAARDE 9052 BE</td>
|
60 |
+
<td></td>
|
61 |
+
<td></td>
|
62 |
+
</tr>
|
63 |
+
<tr>
|
64 |
+
<td>Shipment information</td>
|
65 |
+
<td></td>
|
66 |
+
<td></td>
|
67 |
+
<td></td>
|
68 |
+
<td></td>
|
69 |
+
</tr>
|
70 |
+
<tr>
|
71 |
+
<td>Full description of contents</td>
|
72 |
+
<td></td>
|
73 |
+
<td>Special handling</td>
|
74 |
+
<td></td>
|
75 |
+
<td></td>
|
76 |
+
</tr>
|
77 |
+
<tr>
|
78 |
+
<td>PROTEIN SAMPLES, Deep Frozen Dry Ice -70C [+/-10C]</td>
|
79 |
+
<td>PROTEIN SAMPLES, Deep Frozen Dry Ice -70C [+/-10C]</td>
|
80 |
+
<td></td>
|
81 |
+
<td></td>
|
82 |
+
<td></td>
|
83 |
+
</tr>
|
84 |
+
</table>
|
85 |
+
<hr>
|
86 |
+
</div>
|
87 |
+
|
88 |
+
<div class="table-container">
|
89 |
+
<h2>Table 2</h2>
|
90 |
+
<table border="1">
|
91 |
+
<tr>
|
92 |
+
<td>Number of pieces</td>
|
93 |
+
<td>:unselected: Weight LBS</td>
|
94 |
+
<td>Dimensions</td>
|
95 |
+
<td>:selected: CM</td>
|
96 |
+
<td>Does this shipment contain dangerous goods?</td>
|
97 |
+
<td>Does this shipment contain dangerous goods?</td>
|
98 |
+
<td></td>
|
99 |
+
</tr>
|
100 |
+
<tr>
|
101 |
+
<td>1</td>
|
102 |
+
<td>:selected: 22 KGS</td>
|
103 |
+
<td>53 X 36 X 44</td>
|
104 |
+
<td>:unselected: IN</td>
|
105 |
+
<td>:unselected: NO</td>
|
106 |
+
<td>:unselected: YES (Per attached shipper's declaration)</td>
|
107 |
+
<td>:selected:
|
108 |
+
YES (Shipper's declaration not required)</td>
|
109 |
+
</tr>
|
110 |
+
</table>
|
111 |
+
<hr>
|
112 |
+
</div>
|
113 |
+
|
114 |
+
<div class="table-container">
|
115 |
+
<h2>Table 3</h2>
|
116 |
+
<table border="1">
|
117 |
+
<tr>
|
118 |
+
<td>Country of origin</td>
|
119 |
+
<td>Declared value for customs</td>
|
120 |
+
<td>Declared value for carriage Check if surcharge elected</td>
|
121 |
+
</tr>
|
122 |
+
<tr>
|
123 |
+
<td></td>
|
124 |
+
<td>10.00 USD</td>
|
125 |
+
<td>:unselected:</td>
|
126 |
+
</tr>
|
127 |
+
</table>
|
128 |
+
<hr>
|
129 |
+
</div>
|
130 |
+
|
131 |
+
<div class="table-container">
|
132 |
+
<h2>Table 4</h2>
|
133 |
+
<table border="1">
|
134 |
+
<tr>
|
135 |
+
<td>Print name of shipper or shipper's agent Jesline Ang</td>
|
136 |
+
<td>Date 19 Mag25</td>
|
137 |
+
<td>Print name of consignee or consignee's agent Gavein Vanden Albeck</td>
|
138 |
+
<td>Date</td>
|
139 |
+
</tr>
|
140 |
+
<tr>
|
141 |
+
<td>Print name of shipper or shipper's agent Jesline Ang</td>
|
142 |
+
<td>Date 19 Mag25</td>
|
143 |
+
<td>Print name of consignee or consignee's agent Gavein Vanden Albeck</td>
|
144 |
+
<td>27/05/2025</td>
|
145 |
+
</tr>
|
146 |
+
<tr>
|
147 |
+
<td>Signature of shipper or shipper's agent
|
148 |
+
:selected:</td>
|
149 |
+
<td>Time</td>
|
150 |
+
<td>Signature of consignee or consignee's agent</td>
|
151 |
+
<td>Time</td>
|
152 |
+
</tr>
|
153 |
+
<tr>
|
154 |
+
<td>$
|
155 |
+
:selected:</td>
|
156 |
+
<td>1230</td>
|
157 |
+
<td>Estudia</td>
|
158 |
+
<td>gu 25</td>
|
159 |
+
</tr>
|
160 |
+
</table>
|
161 |
+
<hr>
|
162 |
+
</div>
|
163 |
+
|
164 |
+
<div class="table-container">
|
165 |
+
<h2>Table 5</h2>
|
166 |
+
<table border="1">
|
167 |
+
<tr>
|
168 |
+
<td>Company Reg. No</td>
|
169 |
+
<td>:200614708M</td>
|
170 |
+
</tr>
|
171 |
+
<tr>
|
172 |
+
<td>MGST Reg. No.</td>
|
173 |
+
<td>:20-0614708-M</td>
|
174 |
+
</tr>
|
175 |
+
</table>
|
176 |
+
<hr>
|
177 |
+
</div>
|
178 |
+
|
179 |
+
<div class="table-container">
|
180 |
+
<h2>Table 6</h2>
|
181 |
+
<table border="1">
|
182 |
+
<tr>
|
183 |
+
<td>Shipping Invoice no:</td>
|
184 |
+
<td>LBT/PI/2025/481</td>
|
185 |
+
</tr>
|
186 |
+
<tr>
|
187 |
+
<td>Dated:</td>
|
188 |
+
<td>5/19/2025</td>
|
189 |
+
</tr>
|
190 |
+
</table>
|
191 |
+
<hr>
|
192 |
+
</div>
|
193 |
+
|
194 |
+
<div class="table-container">
|
195 |
+
<h2>Table 7</h2>
|
196 |
+
<table border="1">
|
197 |
+
<tr>
|
198 |
+
<td>Contact Person :</td>
|
199 |
+
<td>Lim Ngian Gin/Jesline Ang</td>
|
200 |
+
</tr>
|
201 |
+
<tr>
|
202 |
+
<td>Telephone:</td>
|
203 |
+
<td>+6565213671/+65213959</td>
|
204 |
+
</tr>
|
205 |
+
<tr>
|
206 |
+
<td>Email:</td>
|
207 |
+
<td>[email protected]</td>
|
208 |
+
</tr>
|
209 |
+
<tr>
|
210 |
+
<td>Freight charges</td>
|
211 |
+
<td>WC acct # 354089 (6300005106)</td>
|
212 |
+
</tr>
|
213 |
+
</table>
|
214 |
+
<hr>
|
215 |
+
</div>
|
216 |
+
|
217 |
+
<div class="table-container">
|
218 |
+
<h2>Table 8</h2>
|
219 |
+
<table border="1">
|
220 |
+
<tr>
|
221 |
+
<td>Contact Person :</td>
|
222 |
+
<td>Michelle de Meyer</td>
|
223 |
+
</tr>
|
224 |
+
<tr>
|
225 |
+
<td>Telephone:</td>
|
226 |
+
<td>+32 9 310 34 00</td>
|
227 |
+
</tr>
|
228 |
+
<tr>
|
229 |
+
<td>Email:</td>
|
230 |
+
<td>[email protected]</td>
|
231 |
+
</tr>
|
232 |
+
</table>
|
233 |
+
<hr>
|
234 |
+
</div>
|
235 |
+
|
236 |
+
<div class="table-container">
|
237 |
+
<h2>Table 9</h2>
|
238 |
+
<table border="1">
|
239 |
+
<tr>
|
240 |
+
<td>Shipper's Reference:</td>
|
241 |
+
<td>LBT/PI/2025/481</td>
|
242 |
+
</tr>
|
243 |
+
<tr>
|
244 |
+
<td>Shipping Terms:</td>
|
245 |
+
<td>Ex work</td>
|
246 |
+
</tr>
|
247 |
+
<tr>
|
248 |
+
<td>Dimension of Box (LXWXH)</td>
|
249 |
+
<td>E89 (53x35.5x44cm)</td>
|
250 |
+
</tr>
|
251 |
+
<tr>
|
252 |
+
<td>Gross Weight:</td>
|
253 |
+
<td>22 KG</td>
|
254 |
+
</tr>
|
255 |
+
<tr>
|
256 |
+
<td>No of Boxes:</td>
|
257 |
+
<td>1</td>
|
258 |
+
</tr>
|
259 |
+
<tr>
|
260 |
+
<td>Country of Origin:</td>
|
261 |
+
<td>Singapore</td>
|
262 |
+
</tr>
|
263 |
+
</table>
|
264 |
+
<hr>
|
265 |
+
</div>
|
266 |
+
|
267 |
+
<div class="table-container">
|
268 |
+
<h2>Table 10</h2>
|
269 |
+
<table border="1">
|
270 |
+
<tr>
|
271 |
+
<td>HAWB:</td>
|
272 |
+
<td>716450106</td>
|
273 |
+
</tr>
|
274 |
+
<tr>
|
275 |
+
<td>Shipment condition:</td>
|
276 |
+
<td>Dry ice</td>
|
277 |
+
</tr>
|
278 |
+
<tr>
|
279 |
+
<td>NET WT:</td>
|
280 |
+
<td>20 KG</td>
|
281 |
+
</tr>
|
282 |
+
</table>
|
283 |
+
<hr>
|
284 |
+
</div>
|
285 |
+
|
286 |
+
<div class="table-container">
|
287 |
+
<h2>Table 11</h2>
|
288 |
+
<table border="1">
|
289 |
+
<tr>
|
290 |
+
<td>Description of Goods</td>
|
291 |
+
<td>Quantity</td>
|
292 |
+
<td>Value of Goods</td>
|
293 |
+
</tr>
|
294 |
+
<tr>
|
295 |
+
<td>3060 Stability Timepoint Sample, T=12M Lot Number - 1233490 HS Code : 3002.00.00</td>
|
296 |
+
<td>4 x 2mL</td>
|
297 |
+
<td>10</td>
|
298 |
+
</tr>
|
299 |
+
<tr>
|
300 |
+
<td>Origin: CHO Genus/Species: Cricetulus Griseus The samples are mixture of highly purified Protien samples and Cell Culture fluids. The intended use of these samples is for laboratory analysis only. Material is recombinant, but contains no genes or expresses no products of exotic livestock or poultry disease agents. These samples do not come from a facility where work with exotic viruses affecting livestock and avian species is conducted .. The product was highly purified to remove all cell material, DNA and animal substances. The samples do not contain any active pharmaceutical/drug</td>
|
301 |
+
<td></td>
|
302 |
+
<td></td>
|
303 |
+
</tr>
|
304 |
+
</table>
|
305 |
+
<hr>
|
306 |
+
</div>
|
307 |
+
|
308 |
+
<div class="table-container">
|
309 |
+
<h2>Table 12</h2>
|
310 |
+
<table border="1">
|
311 |
+
<tr>
|
312 |
+
<td>Customer Code</td>
|
313 |
+
<td>Stability Protocol</td>
|
314 |
+
<td>Lot #</td>
|
315 |
+
<td>Storage Condition</td>
|
316 |
+
<td>Timepoint</td>
|
317 |
+
<td>Test</td>
|
318 |
+
<td>Aliquot Volume</td>
|
319 |
+
<td>Aliquot Container</td>
|
320 |
+
<td>Shipping Temperature (deg C)</td>
|
321 |
+
<td>LIMS ID</td>
|
322 |
+
<td></td>
|
323 |
+
</tr>
|
324 |
+
<tr>
|
325 |
+
<td>3060</td>
|
326 |
+
<td>SGTS-34842</td>
|
327 |
+
<td>1233490</td>
|
328 |
+
<td>-70 deg C</td>
|
329 |
+
<td>T=12M</td>
|
330 |
+
<td>N/A (Customer Sample)</td>
|
331 |
+
<td>:selected: 1 x 2mL</td>
|
332 |
+
<td>PP Tube</td>
|
333 |
+
<td>≤-65</td>
|
334 |
+
<td>1 BA- :selected:</td>
|
335 |
+
<td>2244197</td>
|
336 |
+
</tr>
|
337 |
+
<tr>
|
338 |
+
<td>3060</td>
|
339 |
+
<td>SGTS-34842</td>
|
340 |
+
<td>1233490</td>
|
341 |
+
<td>-40 deg C</td>
|
342 |
+
<td>T=12M</td>
|
343 |
+
<td>N/A (Customer Sample)</td>
|
344 |
+
<td>:selected: 1 x 2mL
|
345 |
+
Y</td>
|
346 |
+
<td>PP Tube</td>
|
347 |
+
<td>≤-65</td>
|
348 |
+
<td>1 FBA-
|
349 |
+
:selected:</td>
|
350 |
+
<td>2244196</td>
|
351 |
+
</tr>
|
352 |
+
<tr>
|
353 |
+
<td>3060</td>
|
354 |
+
<td>SGTS-34842</td>
|
355 |
+
<td>1233490</td>
|
356 |
+
<td>+25 deg C</td>
|
357 |
+
<td>T=12M</td>
|
358 |
+
<td>N/A (Customer Sample)</td>
|
359 |
+
<td>4
|
360 |
+
:selected: 1 x 2mL</td>
|
361 |
+
<td>PP Tube</td>
|
362 |
+
<td>≤-65</td>
|
363 |
+
<td>1 TBA- :selected:</td>
|
364 |
+
<td>2244199</td>
|
365 |
+
</tr>
|
366 |
+
<tr>
|
367 |
+
<td>3060</td>
|
368 |
+
<td>SGTS-34842</td>
|
369 |
+
<td>1233490</td>
|
370 |
+
<td>+5 deg C</td>
|
371 |
+
<td>T=12M</td>
|
372 |
+
<td>N/A (Customer Sample)</td>
|
373 |
+
<td>:selected: 1 x 2mL V</td>
|
374 |
+
<td>PP Tube</td>
|
375 |
+
<td>≤-65</td>
|
376 |
+
<td>TBA- :selected:</td>
|
377 |
+
<td>2244200</td>
|
378 |
+
</tr>
|
379 |
+
</table>
|
380 |
+
<hr>
|
381 |
+
</div>
|
382 |
+
</body></html>
|
logs/di_content/di_content_20250618_142701_tables.html
ADDED
@@ -0,0 +1,1441 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
1 |
+
<!DOCTYPE html>
|
2 |
+
<html>
|
3 |
+
<head>
|
4 |
+
<title>Azure DI Tables</title>
|
5 |
+
<style>
|
6 |
+
body { font-family: Arial, sans-serif; margin: 20px; }
|
7 |
+
.table-container { margin-bottom: 40px; }
|
8 |
+
h2 { color: #333; }
|
9 |
+
table { border-collapse: collapse; width: 100%; margin-bottom: 10px; }
|
10 |
+
th, td { border: 1px solid #ddd; padding: 8px; text-align: left; }
|
11 |
+
th { background-color: #f5f5f5; }
|
12 |
+
hr { border: none; border-top: 2px solid #ccc; margin: 20px 0; }
|
13 |
+
</style>
|
14 |
+
</head>
|
15 |
+
<body>
|
16 |
+
<h1>Azure Document Intelligence Tables</h1>
|
17 |
+
|
18 |
+
<div class="table-container">
|
19 |
+
<h2>Table 1</h2>
|
20 |
+
<table border="1">
|
21 |
+
<tr>
|
22 |
+
<td>l Sales quote:</td>
|
23 |
+
<td>SQ20202722</td>
|
24 |
+
</tr>
|
25 |
+
<tr>
|
26 |
+
<td>l Project code:</td>
|
27 |
+
<td>P3016</td>
|
28 |
+
</tr>
|
29 |
+
<tr>
|
30 |
+
<td>l LNB number:</td>
|
31 |
+
<td>2023.050</td>
|
32 |
+
</tr>
|
33 |
+
<tr>
|
34 |
+
<td>l Project responsible:</td>
|
35 |
+
<td>Nathan Cardon</td>
|
36 |
+
</tr>
|
37 |
+
<tr>
|
38 |
+
<td>l Report name:</td>
|
39 |
+
<td>P3016_R11_v00</td>
|
40 |
+
</tr>
|
41 |
+
</table>
|
42 |
+
<hr>
|
43 |
+
</div>
|
44 |
+
|
45 |
+
<div class="table-container">
|
46 |
+
<h2>Table 2</h2>
|
47 |
+
<table border="1">
|
48 |
+
<tr>
|
49 |
+
<td>Test sample ID client</td>
|
50 |
+
<td>Test sample ID RIC</td>
|
51 |
+
<td>Protein concentration (mg/ML)</td>
|
52 |
+
</tr>
|
53 |
+
<tr>
|
54 |
+
<td>P066_FH0.7-0-hulgG-LALAPG-FJB</td>
|
55 |
+
<td>aFH0.7_T0</td>
|
56 |
+
<td>1.0</td>
|
57 |
+
</tr>
|
58 |
+
<tr>
|
59 |
+
<td>P066_FH0.7-0-hulgG-LALAPG-FJB</td>
|
60 |
+
<td>aFH.07_T4W</td>
|
61 |
+
<td>1.0</td>
|
62 |
+
</tr>
|
63 |
+
<tr>
|
64 |
+
<td>P066_FHR-1.3B4_0-hulgG-LALAPG-FJB</td>
|
65 |
+
<td>FHR-1.3B4_T0</td>
|
66 |
+
<td>1.0</td>
|
67 |
+
</tr>
|
68 |
+
<tr>
|
69 |
+
<td>P066_FHR-1.3B4_0-hulgG-LALAPG-FJB</td>
|
70 |
+
<td>FHR-1.3B4_T4W</td>
|
71 |
+
<td>1.0</td>
|
72 |
+
</tr>
|
73 |
+
<tr>
|
74 |
+
<td>P066_L5_H12_0-hulgG-LALAPG-FJB</td>
|
75 |
+
<td>L5_H12_T0</td>
|
76 |
+
<td>1.0</td>
|
77 |
+
</tr>
|
78 |
+
<tr>
|
79 |
+
<td>P066_L5_H12_0-hulgG-LALAPG-FJB</td>
|
80 |
+
<td>L5_H12_T4W</td>
|
81 |
+
<td>1.0</td>
|
82 |
+
</tr>
|
83 |
+
<tr>
|
84 |
+
<td>P066_L5_H31-0-hulgG-LALAPG-FJB</td>
|
85 |
+
<td>L5_H31_T0</td>
|
86 |
+
<td>1.0</td>
|
87 |
+
</tr>
|
88 |
+
<tr>
|
89 |
+
<td>P066_L5_H31-0-hulgG-LALAPG-FJB</td>
|
90 |
+
<td>L5_H31_T4W</td>
|
91 |
+
<td>1.0</td>
|
92 |
+
</tr>
|
93 |
+
<tr>
|
94 |
+
<td>P066_L14_H12_0-hulgG-LALAPG-FJB</td>
|
95 |
+
<td>L14_H12_T0</td>
|
96 |
+
<td>1.0</td>
|
97 |
+
</tr>
|
98 |
+
<tr>
|
99 |
+
<td>P066_L14_H12_0-hulgG-LALAPG-FJB</td>
|
100 |
+
<td>L14_H12_T4W</td>
|
101 |
+
<td>1.0</td>
|
102 |
+
</tr>
|
103 |
+
<tr>
|
104 |
+
<td>P066_L14_H31_0-hulgG-LALAPG-FJB</td>
|
105 |
+
<td>L14_H31_T0</td>
|
106 |
+
<td>1.0</td>
|
107 |
+
</tr>
|
108 |
+
<tr>
|
109 |
+
<td>P066_L14_H31_0-hulgG-LALAPG-FJB</td>
|
110 |
+
<td>L14-H31_T4W</td>
|
111 |
+
<td>1.0</td>
|
112 |
+
</tr>
|
113 |
+
</table>
|
114 |
+
<hr>
|
115 |
+
</div>
|
116 |
+
|
117 |
+
<div class="table-container">
|
118 |
+
<h2>Table 3</h2>
|
119 |
+
<table border="1">
|
120 |
+
<tr>
|
121 |
+
<td></td>
|
122 |
+
<td>aFH.07_T0</td>
|
123 |
+
<td>aFH.07_T4W</td>
|
124 |
+
</tr>
|
125 |
+
<tr>
|
126 |
+
<td>G0-GlcNAc</td>
|
127 |
+
<td>5.0%</td>
|
128 |
+
<td>4.5%</td>
|
129 |
+
</tr>
|
130 |
+
<tr>
|
131 |
+
<td>Man5</td>
|
132 |
+
<td>56.1%</td>
|
133 |
+
<td>56.3%</td>
|
134 |
+
</tr>
|
135 |
+
<tr>
|
136 |
+
<td>Man6</td>
|
137 |
+
<td>17.6%</td>
|
138 |
+
<td>17.4%</td>
|
139 |
+
</tr>
|
140 |
+
<tr>
|
141 |
+
<td>Man7</td>
|
142 |
+
<td>20.7%</td>
|
143 |
+
<td>21.6%</td>
|
144 |
+
</tr>
|
145 |
+
<tr>
|
146 |
+
<td>Man8</td>
|
147 |
+
<td>0.6%</td>
|
148 |
+
<td>0.2%</td>
|
149 |
+
</tr>
|
150 |
+
</table>
|
151 |
+
<hr>
|
152 |
+
</div>
|
153 |
+
|
154 |
+
<div class="table-container">
|
155 |
+
<h2>Table 4</h2>
|
156 |
+
<table border="1">
|
157 |
+
<tr>
|
158 |
+
<td></td>
|
159 |
+
<td>aFH.07_T0</td>
|
160 |
+
<td>aFH.07_T4W</td>
|
161 |
+
</tr>
|
162 |
+
<tr>
|
163 |
+
<td>Unknown peak</td>
|
164 |
+
<td>0.6%</td>
|
165 |
+
<td>1.3%</td>
|
166 |
+
</tr>
|
167 |
+
<tr>
|
168 |
+
<td>HC [G0F/G0] - 2*GlcNAc</td>
|
169 |
+
<td>1.5%</td>
|
170 |
+
<td>2.0%</td>
|
171 |
+
</tr>
|
172 |
+
<tr>
|
173 |
+
<td>HC [Man5-Man5]</td>
|
174 |
+
<td>16.7%</td>
|
175 |
+
<td>16.5%</td>
|
176 |
+
</tr>
|
177 |
+
<tr>
|
178 |
+
<td>HC [G0F-Man5]</td>
|
179 |
+
<td>10.9%</td>
|
180 |
+
<td>11.9%</td>
|
181 |
+
</tr>
|
182 |
+
<tr>
|
183 |
+
<td>HC [G0F/G0] - GlcNAc</td>
|
184 |
+
<td>16.5%</td>
|
185 |
+
<td>17.2%</td>
|
186 |
+
</tr>
|
187 |
+
<tr>
|
188 |
+
<td>HC [G0F/G0]</td>
|
189 |
+
<td>6.5%</td>
|
190 |
+
<td>6.0%</td>
|
191 |
+
</tr>
|
192 |
+
<tr>
|
193 |
+
<td>HC [G0F/G0F]</td>
|
194 |
+
<td>35.5%</td>
|
195 |
+
<td>33.8%</td>
|
196 |
+
</tr>
|
197 |
+
<tr>
|
198 |
+
<td>HC [G0F/G1F]</td>
|
199 |
+
<td>6.5%</td>
|
200 |
+
<td>5.9%</td>
|
201 |
+
</tr>
|
202 |
+
<tr>
|
203 |
+
<td>HC [G1F/G1F] or HC [G0F/G2F]</td>
|
204 |
+
<td>5.0%</td>
|
205 |
+
<td>4.8%</td>
|
206 |
+
</tr>
|
207 |
+
<tr>
|
208 |
+
<td>HC [G1F/G2F]</td>
|
209 |
+
<td>0.3%</td>
|
210 |
+
<td>0.6%</td>
|
211 |
+
</tr>
|
212 |
+
</table>
|
213 |
+
<hr>
|
214 |
+
</div>
|
215 |
+
|
216 |
+
<div class="table-container">
|
217 |
+
<h2>Table 5</h2>
|
218 |
+
<table border="1">
|
219 |
+
<tr>
|
220 |
+
<td>Sequence</td>
|
221 |
+
<td>Sequence location</td>
|
222 |
+
<td>Modification</td>
|
223 |
+
<td>Relative abundance</td>
|
224 |
+
<td>Relative abundance</td>
|
225 |
+
</tr>
|
226 |
+
<tr>
|
227 |
+
<td>Sequence</td>
|
228 |
+
<td>Sequence location</td>
|
229 |
+
<td>Modification</td>
|
230 |
+
<td>aFH.07_T0</td>
|
231 |
+
<td>aFH.07_T4W</td>
|
232 |
+
</tr>
|
233 |
+
<tr>
|
234 |
+
<td>QIVLSQSPTFLSASPGEK</td>
|
235 |
+
<td>LC (001-018)</td>
|
236 |
+
<td>pyroQ</td>
|
237 |
+
<td>86.8%</td>
|
238 |
+
<td>99.7%</td>
|
239 |
+
</tr>
|
240 |
+
<tr>
|
241 |
+
<td>QIVLSQSPTFLSASPGEK</td>
|
242 |
+
<td>LC (001-018)</td>
|
243 |
+
<td></td>
|
244 |
+
<td>13.2%</td>
|
245 |
+
<td>0.3%</td>
|
246 |
+
</tr>
|
247 |
+
<tr>
|
248 |
+
<td>QVQLQQSGPGLVQPSQSLSITCTVSDFSLAR</td>
|
249 |
+
<td>HC (001-031)</td>
|
250 |
+
<td>pyroQ</td>
|
251 |
+
<td>90.0%</td>
|
252 |
+
<td>100.0%</td>
|
253 |
+
</tr>
|
254 |
+
<tr>
|
255 |
+
<td>QVQLQQSGPGLVQPSQSLSITCTVSDFSLAR</td>
|
256 |
+
<td>HC (001-031)</td>
|
257 |
+
<td></td>
|
258 |
+
<td>10.0%</td>
|
259 |
+
<td>n.d</td>
|
260 |
+
</tr>
|
261 |
+
</table>
|
262 |
+
<hr>
|
263 |
+
</div>
|
264 |
+
|
265 |
+
<div class="table-container">
|
266 |
+
<h2>Table 6</h2>
|
267 |
+
<table border="1">
|
268 |
+
<tr>
|
269 |
+
<td>Sequence</td>
|
270 |
+
<td>Sequence location</td>
|
271 |
+
<td>Modification</td>
|
272 |
+
<td>Relative abundance</td>
|
273 |
+
<td>Relative abundance</td>
|
274 |
+
</tr>
|
275 |
+
<tr>
|
276 |
+
<td>Sequence</td>
|
277 |
+
<td>Sequence location</td>
|
278 |
+
<td>Modification</td>
|
279 |
+
<td>aFH.07_T0</td>
|
280 |
+
<td>aFH.07_T4W</td>
|
281 |
+
</tr>
|
282 |
+
<tr>
|
283 |
+
<td>YMHWYQQKPGASPKPWIFATSNLASGVPAR</td>
|
284 |
+
<td>LC (31-60)</td>
|
285 |
+
<td>Oxidation [+16 Da]</td>
|
286 |
+
<td>0.9%</td>
|
287 |
+
<td>1.0%</td>
|
288 |
+
</tr>
|
289 |
+
<tr>
|
290 |
+
<td>YMHWYQQKPGASPKPWIFATSNLASGVPAR</td>
|
291 |
+
<td>LC (31-60)</td>
|
292 |
+
<td></td>
|
293 |
+
<td>99.1%</td>
|
294 |
+
<td>99.0%</td>
|
295 |
+
</tr>
|
296 |
+
</table>
|
297 |
+
<hr>
|
298 |
+
</div>
|
299 |
+
|
300 |
+
<div class="table-container">
|
301 |
+
<h2>Table 7</h2>
|
302 |
+
<table border="1">
|
303 |
+
<tr>
|
304 |
+
<td>Sequence</td>
|
305 |
+
<td>Sequence location</td>
|
306 |
+
<td>Modification</td>
|
307 |
+
<td>Relative abundance</td>
|
308 |
+
<td>Relative abundance</td>
|
309 |
+
</tr>
|
310 |
+
<tr>
|
311 |
+
<td>Sequence</td>
|
312 |
+
<td>Sequence location</td>
|
313 |
+
<td>Modification</td>
|
314 |
+
<td>aFH.07_T0</td>
|
315 |
+
<td>aFH.07_T4W</td>
|
316 |
+
</tr>
|
317 |
+
<tr>
|
318 |
+
<td>LNINKDNSK</td>
|
319 |
+
<td>HC (72-75)</td>
|
320 |
+
<td></td>
|
321 |
+
<td>99.5%</td>
|
322 |
+
<td>98.9%</td>
|
323 |
+
</tr>
|
324 |
+
<tr>
|
325 |
+
<td>LNINKDNSK</td>
|
326 |
+
<td>HC (72-75)</td>
|
327 |
+
<td>Deamidation</td>
|
328 |
+
<td>0.5%</td>
|
329 |
+
<td>1.1%</td>
|
330 |
+
</tr>
|
331 |
+
</table>
|
332 |
+
<hr>
|
333 |
+
</div>
|
334 |
+
|
335 |
+
<div class="table-container">
|
336 |
+
<h2>Table 8</h2>
|
337 |
+
<table border="1">
|
338 |
+
<tr>
|
339 |
+
<td>Sequence</td>
|
340 |
+
<td>Sequence location</td>
|
341 |
+
<td>Modification</td>
|
342 |
+
<td>Relative abundance</td>
|
343 |
+
<td>Relative abundance</td>
|
344 |
+
</tr>
|
345 |
+
<tr>
|
346 |
+
<td>Sequence</td>
|
347 |
+
<td>Sequence location</td>
|
348 |
+
<td>Modification</td>
|
349 |
+
<td>aFH.07_T0</td>
|
350 |
+
<td>aFH.07_T4W</td>
|
351 |
+
</tr>
|
352 |
+
<tr>
|
353 |
+
<td>VEAEDAATYYCQQWSIIPPTFGNGTK</td>
|
354 |
+
<td>LC (77-102)</td>
|
355 |
+
<td>GO-GICNAc</td>
|
356 |
+
<td>2.6%</td>
|
357 |
+
<td>4.0%</td>
|
358 |
+
</tr>
|
359 |
+
<tr>
|
360 |
+
<td>VEAEDAATYYCQQWSIIPPTFGNGTK</td>
|
361 |
+
<td>LC (77-102)</td>
|
362 |
+
<td>Man5</td>
|
363 |
+
<td>54.9%</td>
|
364 |
+
<td>57.3%</td>
|
365 |
+
</tr>
|
366 |
+
<tr>
|
367 |
+
<td>VEAEDAATYYCQQWSIIPPTFGNGTK</td>
|
368 |
+
<td>LC (77-102)</td>
|
369 |
+
<td>Man6</td>
|
370 |
+
<td>21.1%</td>
|
371 |
+
<td>18.8%</td>
|
372 |
+
</tr>
|
373 |
+
<tr>
|
374 |
+
<td>VEAEDAATYYCQQWSIIPPTFGNGTK</td>
|
375 |
+
<td>LC (77-102)</td>
|
376 |
+
<td>Man7</td>
|
377 |
+
<td>21.4%</td>
|
378 |
+
<td>20.0%</td>
|
379 |
+
</tr>
|
380 |
+
</table>
|
381 |
+
<hr>
|
382 |
+
</div>
|
383 |
+
|
384 |
+
<div class="table-container">
|
385 |
+
<h2>Table 9</h2>
|
386 |
+
<table border="1">
|
387 |
+
<tr>
|
388 |
+
<td>Sequence</td>
|
389 |
+
<td>Sequence location</td>
|
390 |
+
<td>Modification</td>
|
391 |
+
<td>Relative abundance</td>
|
392 |
+
<td>Relative abundance</td>
|
393 |
+
</tr>
|
394 |
+
<tr>
|
395 |
+
<td>Sequence</td>
|
396 |
+
<td>Sequence location</td>
|
397 |
+
<td>Modification</td>
|
398 |
+
<td>aFH.07_T0</td>
|
399 |
+
<td>aFH.07_T4W</td>
|
400 |
+
</tr>
|
401 |
+
<tr>
|
402 |
+
<td>MNSLQANDTAIYYCAR</td>
|
403 |
+
<td>HC (82-97)</td>
|
404 |
+
<td>Non glycosylated</td>
|
405 |
+
<td>n.d</td>
|
406 |
+
<td>n.d</td>
|
407 |
+
</tr>
|
408 |
+
<tr>
|
409 |
+
<td>MNSLQANDTAIYYCAR</td>
|
410 |
+
<td>HC (82-97)</td>
|
411 |
+
<td>G0F-GlcNAc</td>
|
412 |
+
<td>16.3%</td>
|
413 |
+
<td>20.8%</td>
|
414 |
+
</tr>
|
415 |
+
<tr>
|
416 |
+
<td>MNSLQANDTAIYYCAR</td>
|
417 |
+
<td>HC (82-97)</td>
|
418 |
+
<td>G0</td>
|
419 |
+
<td>4.2%</td>
|
420 |
+
<td>3.7%</td>
|
421 |
+
</tr>
|
422 |
+
<tr>
|
423 |
+
<td>MNSLQANDTAIYYCAR</td>
|
424 |
+
<td>HC (82-97)</td>
|
425 |
+
<td>G0F</td>
|
426 |
+
<td>36.5%</td>
|
427 |
+
<td>34.0%</td>
|
428 |
+
</tr>
|
429 |
+
<tr>
|
430 |
+
<td>MNSLQANDTAIYYCAR</td>
|
431 |
+
<td>HC (82-97)</td>
|
432 |
+
<td>G1F</td>
|
433 |
+
<td>4.9%</td>
|
434 |
+
<td>5.1%</td>
|
435 |
+
</tr>
|
436 |
+
<tr>
|
437 |
+
<td>MNSLQANDTAIYYCAR</td>
|
438 |
+
<td>HC (82-97)</td>
|
439 |
+
<td>G2F</td>
|
440 |
+
<td>5.7%</td>
|
441 |
+
<td>4.8%</td>
|
442 |
+
</tr>
|
443 |
+
<tr>
|
444 |
+
<td>MNSLQANDTAIYYCAR</td>
|
445 |
+
<td>HC (82-97)</td>
|
446 |
+
<td>Man5</td>
|
447 |
+
<td>32.4%</td>
|
448 |
+
<td>31.5%</td>
|
449 |
+
</tr>
|
450 |
+
</table>
|
451 |
+
<hr>
|
452 |
+
</div>
|
453 |
+
|
454 |
+
<div class="table-container">
|
455 |
+
<h2>Table 10</h2>
|
456 |
+
<table border="1">
|
457 |
+
<tr>
|
458 |
+
<td>Sequence</td>
|
459 |
+
<td>Sequence location</td>
|
460 |
+
<td>Modification</td>
|
461 |
+
<td>Relative abundance</td>
|
462 |
+
<td>Relative abundance</td>
|
463 |
+
</tr>
|
464 |
+
<tr>
|
465 |
+
<td>Sequence</td>
|
466 |
+
<td>Sequence location</td>
|
467 |
+
<td>Modification</td>
|
468 |
+
<td>aFH.07_T0</td>
|
469 |
+
<td>aFH.07_T4W</td>
|
470 |
+
</tr>
|
471 |
+
<tr>
|
472 |
+
<td>EEQYNSTYR</td>
|
473 |
+
<td>HC (293-301)</td>
|
474 |
+
<td>Non glycosylated</td>
|
475 |
+
<td>n.d</td>
|
476 |
+
<td>n.d</td>
|
477 |
+
</tr>
|
478 |
+
<tr>
|
479 |
+
<td>EEQYNSTYR</td>
|
480 |
+
<td>HC (293-301)</td>
|
481 |
+
<td>Man5</td>
|
482 |
+
<td>20.9%</td>
|
483 |
+
<td>22.5%</td>
|
484 |
+
</tr>
|
485 |
+
<tr>
|
486 |
+
<td>EEQYNSTYR</td>
|
487 |
+
<td>HC (293-301)</td>
|
488 |
+
<td>G0</td>
|
489 |
+
<td>n.D</td>
|
490 |
+
<td>n.d</td>
|
491 |
+
</tr>
|
492 |
+
<tr>
|
493 |
+
<td>EEQYNSTYR</td>
|
494 |
+
<td>HC (293-301)</td>
|
495 |
+
<td>G0F</td>
|
496 |
+
<td>79.1%</td>
|
497 |
+
<td>77.5%</td>
|
498 |
+
</tr>
|
499 |
+
<tr>
|
500 |
+
<td>EEQYNSTYR</td>
|
501 |
+
<td>HC (293-301)</td>
|
502 |
+
<td>G1F</td>
|
503 |
+
<td>n.d</td>
|
504 |
+
<td>n.d</td>
|
505 |
+
</tr>
|
506 |
+
<tr>
|
507 |
+
<td>EEQYNSTYR</td>
|
508 |
+
<td>HC (293-301)</td>
|
509 |
+
<td>G2F</td>
|
510 |
+
<td>n.d</td>
|
511 |
+
<td>n.d</td>
|
512 |
+
</tr>
|
513 |
+
</table>
|
514 |
+
<hr>
|
515 |
+
</div>
|
516 |
+
|
517 |
+
<div class="table-container">
|
518 |
+
<h2>Table 11</h2>
|
519 |
+
<table border="1">
|
520 |
+
<tr>
|
521 |
+
<td>Sequence</td>
|
522 |
+
<td>Sequence location</td>
|
523 |
+
<td>Modification</td>
|
524 |
+
<td>Relative abundance*</td>
|
525 |
+
<td>Relative abundance*</td>
|
526 |
+
</tr>
|
527 |
+
<tr>
|
528 |
+
<td>Sequence</td>
|
529 |
+
<td>Sequence location</td>
|
530 |
+
<td>Modification</td>
|
531 |
+
<td>aFH.07_T0</td>
|
532 |
+
<td>aFH.07_T4W</td>
|
533 |
+
</tr>
|
534 |
+
<tr>
|
535 |
+
<td>STSGGTAALGCLVK</td>
|
536 |
+
<td>HC (134-147)</td>
|
537 |
+
<td></td>
|
538 |
+
<td>99.9%</td>
|
539 |
+
<td>98.8%</td>
|
540 |
+
</tr>
|
541 |
+
<tr>
|
542 |
+
<td>GTAALGCLVK</td>
|
543 |
+
<td>HC (134-147)</td>
|
544 |
+
<td>Clipping</td>
|
545 |
+
<td>0.1%</td>
|
546 |
+
<td>1.2%</td>
|
547 |
+
</tr>
|
548 |
+
</table>
|
549 |
+
<hr>
|
550 |
+
</div>
|
551 |
+
|
552 |
+
<div class="table-container">
|
553 |
+
<h2>Table 12</h2>
|
554 |
+
<table border="1">
|
555 |
+
<tr>
|
556 |
+
<td>Blue:</td>
|
557 |
+
<td>VH and VL</td>
|
558 |
+
</tr>
|
559 |
+
<tr>
|
560 |
+
<td>Blue:</td>
|
561 |
+
<td>CDR</td>
|
562 |
+
</tr>
|
563 |
+
<tr>
|
564 |
+
<td>Green:</td>
|
565 |
+
<td>N-glycosylation site</td>
|
566 |
+
</tr>
|
567 |
+
</table>
|
568 |
+
<hr>
|
569 |
+
</div>
|
570 |
+
|
571 |
+
<div class="table-container">
|
572 |
+
<h2>Table 13</h2>
|
573 |
+
<table border="1">
|
574 |
+
<tr>
|
575 |
+
<td>Sequence</td>
|
576 |
+
<td>Sequence location</td>
|
577 |
+
<td>Modification</td>
|
578 |
+
<td>Relative abundance</td>
|
579 |
+
<td>Relative abundance</td>
|
580 |
+
</tr>
|
581 |
+
<tr>
|
582 |
+
<td>Sequence</td>
|
583 |
+
<td>Sequence location</td>
|
584 |
+
<td>Modification</td>
|
585 |
+
<td>FHR-1.3B4_T0</td>
|
586 |
+
<td>FHR-1.3B4_T4W</td>
|
587 |
+
</tr>
|
588 |
+
<tr>
|
589 |
+
<td>QIVLSQSPTILSASPGEK</td>
|
590 |
+
<td>LC (1-18)</td>
|
591 |
+
<td>pyro Q</td>
|
592 |
+
<td>96.1%</td>
|
593 |
+
<td>100.0%</td>
|
594 |
+
</tr>
|
595 |
+
<tr>
|
596 |
+
<td>QIVLSQSPTILSASPGEK</td>
|
597 |
+
<td>LC (1-18)</td>
|
598 |
+
<td></td>
|
599 |
+
<td>3.9%</td>
|
600 |
+
<td>n.d</td>
|
601 |
+
</tr>
|
602 |
+
<tr>
|
603 |
+
<td>QVQLR</td>
|
604 |
+
<td>HC (1-5)</td>
|
605 |
+
<td>pyro Q</td>
|
606 |
+
<td>96.7%</td>
|
607 |
+
<td>100.0%</td>
|
608 |
+
</tr>
|
609 |
+
<tr>
|
610 |
+
<td>QVQLR</td>
|
611 |
+
<td>HC (1-5)</td>
|
612 |
+
<td></td>
|
613 |
+
<td>3.3%</td>
|
614 |
+
<td>n.d</td>
|
615 |
+
</tr>
|
616 |
+
</table>
|
617 |
+
<hr>
|
618 |
+
</div>
|
619 |
+
|
620 |
+
<div class="table-container">
|
621 |
+
<h2>Table 14</h2>
|
622 |
+
<table border="1">
|
623 |
+
<tr>
|
624 |
+
<td>Sequence</td>
|
625 |
+
<td>Sequence location</td>
|
626 |
+
<td>Modification</td>
|
627 |
+
<td>Relative abundance</td>
|
628 |
+
<td>Relative abundance</td>
|
629 |
+
</tr>
|
630 |
+
<tr>
|
631 |
+
<td>Sequence</td>
|
632 |
+
<td>Sequence location</td>
|
633 |
+
<td>Modification</td>
|
634 |
+
<td>FHR-1.3B4_T0</td>
|
635 |
+
<td>FHR-1.3B4_T4W</td>
|
636 |
+
</tr>
|
637 |
+
<tr>
|
638 |
+
<td>MNSLQADDTAIYYCAR</td>
|
639 |
+
<td>HC (82-97)</td>
|
640 |
+
<td></td>
|
641 |
+
<td>99.3%</td>
|
642 |
+
<td>99.0%</td>
|
643 |
+
</tr>
|
644 |
+
<tr>
|
645 |
+
<td>MNSLQADDTAIYYCAR</td>
|
646 |
+
<td>HC (82-97)</td>
|
647 |
+
<td>Ox [+ 16 Da]</td>
|
648 |
+
<td>0.7%</td>
|
649 |
+
<td>1.0%</td>
|
650 |
+
</tr>
|
651 |
+
</table>
|
652 |
+
<hr>
|
653 |
+
</div>
|
654 |
+
|
655 |
+
<div class="table-container">
|
656 |
+
<h2>Table 15</h2>
|
657 |
+
<table border="1">
|
658 |
+
<tr>
|
659 |
+
<td>Sequence</td>
|
660 |
+
<td>Sequence location</td>
|
661 |
+
<td>Modification</td>
|
662 |
+
<td>Relative abundance</td>
|
663 |
+
<td>Relative abundance</td>
|
664 |
+
</tr>
|
665 |
+
<tr>
|
666 |
+
<td>Sequence</td>
|
667 |
+
<td>Sequence location</td>
|
668 |
+
<td>Modification</td>
|
669 |
+
<td>FHR-1.3B4_T0</td>
|
670 |
+
<td>FHR-1.3B4_T4W</td>
|
671 |
+
</tr>
|
672 |
+
<tr>
|
673 |
+
<td>MNSLQADDTAIYYCAR</td>
|
674 |
+
<td>HC (82-97)</td>
|
675 |
+
<td></td>
|
676 |
+
<td>97.6%</td>
|
677 |
+
<td>79.7%</td>
|
678 |
+
</tr>
|
679 |
+
<tr>
|
680 |
+
<td>MNSLQADDTAIYYCAR</td>
|
681 |
+
<td>HC (82-97)</td>
|
682 |
+
<td>Deamidation</td>
|
683 |
+
<td>2.4%</td>
|
684 |
+
<td>20.3%</td>
|
685 |
+
</tr>
|
686 |
+
</table>
|
687 |
+
<hr>
|
688 |
+
</div>
|
689 |
+
|
690 |
+
<div class="table-container">
|
691 |
+
<h2>Table 16</h2>
|
692 |
+
<table border="1">
|
693 |
+
<tr>
|
694 |
+
<td>Sequence</td>
|
695 |
+
<td>Sequence location</td>
|
696 |
+
<td>Modification</td>
|
697 |
+
<td>Relative abundance*</td>
|
698 |
+
<td>Relative abundance*</td>
|
699 |
+
</tr>
|
700 |
+
<tr>
|
701 |
+
<td>Sequence</td>
|
702 |
+
<td>Sequence location</td>
|
703 |
+
<td>Modification</td>
|
704 |
+
<td>FHR-1.3B4_T0</td>
|
705 |
+
<td>FHR-1.3B4_T4W</td>
|
706 |
+
</tr>
|
707 |
+
<tr>
|
708 |
+
<td>STSGGTAALGCLVK</td>
|
709 |
+
<td>HC (134-147)</td>
|
710 |
+
<td></td>
|
711 |
+
<td>99.9%</td>
|
712 |
+
<td>98.7%</td>
|
713 |
+
</tr>
|
714 |
+
<tr>
|
715 |
+
<td>GTAALGCLVK</td>
|
716 |
+
<td>HC (134-147)</td>
|
717 |
+
<td>Clipping</td>
|
718 |
+
<td>0.1%</td>
|
719 |
+
<td>1.3%</td>
|
720 |
+
</tr>
|
721 |
+
<tr>
|
722 |
+
<td>SSSNPLTFGAGTK</td>
|
723 |
+
<td>LC (91-103)</td>
|
724 |
+
<td></td>
|
725 |
+
<td>99.5%</td>
|
726 |
+
<td>97.3%</td>
|
727 |
+
</tr>
|
728 |
+
<tr>
|
729 |
+
<td>PLTFGAGTK</td>
|
730 |
+
<td>LC (91-103)</td>
|
731 |
+
<td>Clipping</td>
|
732 |
+
<td>0.5%</td>
|
733 |
+
<td>2.7%</td>
|
734 |
+
</tr>
|
735 |
+
</table>
|
736 |
+
<hr>
|
737 |
+
</div>
|
738 |
+
|
739 |
+
<div class="table-container">
|
740 |
+
<h2>Table 17</h2>
|
741 |
+
<table border="1">
|
742 |
+
<tr>
|
743 |
+
<td>Blue:</td>
|
744 |
+
<td>VH and VL</td>
|
745 |
+
</tr>
|
746 |
+
<tr>
|
747 |
+
<td>Blue:</td>
|
748 |
+
<td>CDR</td>
|
749 |
+
</tr>
|
750 |
+
<tr>
|
751 |
+
<td>Green:</td>
|
752 |
+
<td>N-glycosylation site</td>
|
753 |
+
</tr>
|
754 |
+
</table>
|
755 |
+
<hr>
|
756 |
+
</div>
|
757 |
+
|
758 |
+
<div class="table-container">
|
759 |
+
<h2>Table 18</h2>
|
760 |
+
<table border="1">
|
761 |
+
<tr>
|
762 |
+
<td>Sequence</td>
|
763 |
+
<td>Sequence location</td>
|
764 |
+
<td>Modification</td>
|
765 |
+
<td>Relative abundance</td>
|
766 |
+
<td>Relative abundance</td>
|
767 |
+
</tr>
|
768 |
+
<tr>
|
769 |
+
<td>Sequence</td>
|
770 |
+
<td>Sequence location</td>
|
771 |
+
<td>Modification</td>
|
772 |
+
<td>L5-H12_T0</td>
|
773 |
+
<td>L5-H12_T4w</td>
|
774 |
+
</tr>
|
775 |
+
<tr>
|
776 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
777 |
+
<td>HC (001-038)</td>
|
778 |
+
<td>pyro Q</td>
|
779 |
+
<td>85.5%</td>
|
780 |
+
<td>99.3%</td>
|
781 |
+
</tr>
|
782 |
+
<tr>
|
783 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
784 |
+
<td>HC (001-038)</td>
|
785 |
+
<td></td>
|
786 |
+
<td>14.5%</td>
|
787 |
+
<td>0.7%</td>
|
788 |
+
</tr>
|
789 |
+
</table>
|
790 |
+
<hr>
|
791 |
+
</div>
|
792 |
+
|
793 |
+
<div class="table-container">
|
794 |
+
<h2>Table 19</h2>
|
795 |
+
<table border="1">
|
796 |
+
<tr>
|
797 |
+
<td>Sequence</td>
|
798 |
+
<td>Sequence location</td>
|
799 |
+
<td>Modification</td>
|
800 |
+
<td>Relative abundance*</td>
|
801 |
+
<td>Relative abundance*</td>
|
802 |
+
</tr>
|
803 |
+
<tr>
|
804 |
+
<td>Sequence</td>
|
805 |
+
<td>Sequence location</td>
|
806 |
+
<td>Modification</td>
|
807 |
+
<td>L5-H12_T0</td>
|
808 |
+
<td>L5-H12_T4w</td>
|
809 |
+
</tr>
|
810 |
+
<tr>
|
811 |
+
<td>STSGGTAALGCLVK</td>
|
812 |
+
<td>HC (134-147)</td>
|
813 |
+
<td></td>
|
814 |
+
<td>99.9%</td>
|
815 |
+
<td>98.7%</td>
|
816 |
+
</tr>
|
817 |
+
<tr>
|
818 |
+
<td>GTAALGCLVK</td>
|
819 |
+
<td>HC (134-147)</td>
|
820 |
+
<td>Clipping</td>
|
821 |
+
<td>0.1%</td>
|
822 |
+
<td>1.3%</td>
|
823 |
+
</tr>
|
824 |
+
<tr>
|
825 |
+
<td>SSSNPLTFGAGTK</td>
|
826 |
+
<td>LC (91-103)</td>
|
827 |
+
<td></td>
|
828 |
+
<td>99.8%</td>
|
829 |
+
<td>98.9%</td>
|
830 |
+
</tr>
|
831 |
+
<tr>
|
832 |
+
<td>PLTFGAGTK</td>
|
833 |
+
<td>LC (91-103)</td>
|
834 |
+
<td>Clipping</td>
|
835 |
+
<td>0.2%</td>
|
836 |
+
<td>1.1%</td>
|
837 |
+
</tr>
|
838 |
+
</table>
|
839 |
+
<hr>
|
840 |
+
</div>
|
841 |
+
|
842 |
+
<div class="table-container">
|
843 |
+
<h2>Table 20</h2>
|
844 |
+
<table border="1">
|
845 |
+
<tr>
|
846 |
+
<td>Blue:</td>
|
847 |
+
<td>VH and VL</td>
|
848 |
+
</tr>
|
849 |
+
<tr>
|
850 |
+
<td>Blue:</td>
|
851 |
+
<td>CDR</td>
|
852 |
+
</tr>
|
853 |
+
<tr>
|
854 |
+
<td>Green:</td>
|
855 |
+
<td>N-glycosylation site</td>
|
856 |
+
</tr>
|
857 |
+
</table>
|
858 |
+
<hr>
|
859 |
+
</div>
|
860 |
+
|
861 |
+
<div class="table-container">
|
862 |
+
<h2>Table 21</h2>
|
863 |
+
<table border="1">
|
864 |
+
<tr>
|
865 |
+
<td>Sequence</td>
|
866 |
+
<td>Sequence location</td>
|
867 |
+
<td>Modification</td>
|
868 |
+
<td>Relative abundance</td>
|
869 |
+
<td>Relative abundance</td>
|
870 |
+
</tr>
|
871 |
+
<tr>
|
872 |
+
<td>Sequence</td>
|
873 |
+
<td>Sequence location</td>
|
874 |
+
<td>Modification</td>
|
875 |
+
<td>L5-H31_T0</td>
|
876 |
+
<td>L5-H31_T4w</td>
|
877 |
+
</tr>
|
878 |
+
<tr>
|
879 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
880 |
+
<td>HC (001-038)</td>
|
881 |
+
<td>pyro Q</td>
|
882 |
+
<td>83.5%</td>
|
883 |
+
<td>99.5%</td>
|
884 |
+
</tr>
|
885 |
+
<tr>
|
886 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
887 |
+
<td>HC (001-038)</td>
|
888 |
+
<td></td>
|
889 |
+
<td>16.5%</td>
|
890 |
+
<td>0.5%</td>
|
891 |
+
</tr>
|
892 |
+
</table>
|
893 |
+
<hr>
|
894 |
+
</div>
|
895 |
+
|
896 |
+
<div class="table-container">
|
897 |
+
<h2>Table 22</h2>
|
898 |
+
<table border="1">
|
899 |
+
<tr>
|
900 |
+
<td>Sequence</td>
|
901 |
+
<td>Sequence location</td>
|
902 |
+
<td>Modification</td>
|
903 |
+
<td>Relative abundance</td>
|
904 |
+
<td>Relative abundance</td>
|
905 |
+
</tr>
|
906 |
+
<tr>
|
907 |
+
<td>Sequence</td>
|
908 |
+
<td>Sequence location</td>
|
909 |
+
<td>Modification</td>
|
910 |
+
<td>L5-H31_T0</td>
|
911 |
+
<td>L5-H31_T4w</td>
|
912 |
+
</tr>
|
913 |
+
<tr>
|
914 |
+
<td>NFGNYAMDFWGQGTSVTVSSASTK</td>
|
915 |
+
<td>HC(98-121)</td>
|
916 |
+
<td>Ox. [+ 16 Da]</td>
|
917 |
+
<td>4.9%</td>
|
918 |
+
<td>1.9%</td>
|
919 |
+
</tr>
|
920 |
+
<tr>
|
921 |
+
<td>NFGNYAMDFWGQGTSVTVSSASTK</td>
|
922 |
+
<td>HC(98-121)</td>
|
923 |
+
<td></td>
|
924 |
+
<td>95.1%</td>
|
925 |
+
<td>98.1%</td>
|
926 |
+
</tr>
|
927 |
+
</table>
|
928 |
+
<hr>
|
929 |
+
</div>
|
930 |
+
|
931 |
+
<div class="table-container">
|
932 |
+
<h2>Table 23</h2>
|
933 |
+
<table border="1">
|
934 |
+
<tr>
|
935 |
+
<td>Sequence</td>
|
936 |
+
<td>Sequence location</td>
|
937 |
+
<td>Modification</td>
|
938 |
+
<td>Relative abundance</td>
|
939 |
+
<td>Relative abundance</td>
|
940 |
+
</tr>
|
941 |
+
<tr>
|
942 |
+
<td>Sequence</td>
|
943 |
+
<td>Sequence location</td>
|
944 |
+
<td>Modification</td>
|
945 |
+
<td>L5-H31_T0</td>
|
946 |
+
<td>L5-H31_T4w</td>
|
947 |
+
</tr>
|
948 |
+
<tr>
|
949 |
+
<td>SSSNPLTFGAGTK</td>
|
950 |
+
<td>LC (91-103)</td>
|
951 |
+
<td></td>
|
952 |
+
<td>99.8%</td>
|
953 |
+
<td>99.5%</td>
|
954 |
+
</tr>
|
955 |
+
<tr>
|
956 |
+
<td>SSSNPLTFGAGTK</td>
|
957 |
+
<td>LC (91-103)</td>
|
958 |
+
<td>deamidation</td>
|
959 |
+
<td>0.2%</td>
|
960 |
+
<td>0.5%</td>
|
961 |
+
</tr>
|
962 |
+
</table>
|
963 |
+
<hr>
|
964 |
+
</div>
|
965 |
+
|
966 |
+
<div class="table-container">
|
967 |
+
<h2>Table 24</h2>
|
968 |
+
<table border="1">
|
969 |
+
<tr>
|
970 |
+
<td>Sequence</td>
|
971 |
+
<td>Sequence location</td>
|
972 |
+
<td>Modification</td>
|
973 |
+
<td>Relative abundance*</td>
|
974 |
+
<td>Relative abundance*</td>
|
975 |
+
</tr>
|
976 |
+
<tr>
|
977 |
+
<td>Sequence</td>
|
978 |
+
<td>Sequence location</td>
|
979 |
+
<td>Modification</td>
|
980 |
+
<td>L5-H31_T0</td>
|
981 |
+
<td>L5-H31_T4w</td>
|
982 |
+
</tr>
|
983 |
+
<tr>
|
984 |
+
<td>STSGGTAALGCLVK</td>
|
985 |
+
<td>HC (134-147)</td>
|
986 |
+
<td></td>
|
987 |
+
<td>99.9%</td>
|
988 |
+
<td>98.8%</td>
|
989 |
+
</tr>
|
990 |
+
<tr>
|
991 |
+
<td>GTAALGCLVK</td>
|
992 |
+
<td>HC (134-147)</td>
|
993 |
+
<td>Clipping</td>
|
994 |
+
<td>0.1%</td>
|
995 |
+
<td>1.2%</td>
|
996 |
+
</tr>
|
997 |
+
<tr>
|
998 |
+
<td>SSSNPLTFGAGTK</td>
|
999 |
+
<td>LC (91-103)</td>
|
1000 |
+
<td></td>
|
1001 |
+
<td>99.9%</td>
|
1002 |
+
<td>98.8%</td>
|
1003 |
+
</tr>
|
1004 |
+
<tr>
|
1005 |
+
<td>PLTFGAGTK</td>
|
1006 |
+
<td>LC (91-103)</td>
|
1007 |
+
<td>Clipping</td>
|
1008 |
+
<td>0.1%</td>
|
1009 |
+
<td>1.2%</td>
|
1010 |
+
</tr>
|
1011 |
+
</table>
|
1012 |
+
<hr>
|
1013 |
+
</div>
|
1014 |
+
|
1015 |
+
<div class="table-container">
|
1016 |
+
<h2>Table 25</h2>
|
1017 |
+
<table border="1">
|
1018 |
+
<tr>
|
1019 |
+
<td>Blue:</td>
|
1020 |
+
<td>VH and VL</td>
|
1021 |
+
</tr>
|
1022 |
+
<tr>
|
1023 |
+
<td>Blue:</td>
|
1024 |
+
<td>CDR</td>
|
1025 |
+
</tr>
|
1026 |
+
<tr>
|
1027 |
+
<td>Green:</td>
|
1028 |
+
<td>N-glycosylation site</td>
|
1029 |
+
</tr>
|
1030 |
+
</table>
|
1031 |
+
<hr>
|
1032 |
+
</div>
|
1033 |
+
|
1034 |
+
<div class="table-container">
|
1035 |
+
<h2>Table 26</h2>
|
1036 |
+
<table border="1">
|
1037 |
+
<tr>
|
1038 |
+
<td>Sequence</td>
|
1039 |
+
<td>Sequence location</td>
|
1040 |
+
<td>Modification</td>
|
1041 |
+
<td>Relative abundance</td>
|
1042 |
+
<td>Relative abundance</td>
|
1043 |
+
</tr>
|
1044 |
+
<tr>
|
1045 |
+
<td>Sequence</td>
|
1046 |
+
<td>Sequence location</td>
|
1047 |
+
<td>Modification</td>
|
1048 |
+
<td>L14-H12_T0</td>
|
1049 |
+
<td>L14-H12_T4w</td>
|
1050 |
+
</tr>
|
1051 |
+
<tr>
|
1052 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
1053 |
+
<td>HC(001-038)</td>
|
1054 |
+
<td>pyroQ</td>
|
1055 |
+
<td>85.9%</td>
|
1056 |
+
<td>99.3%</td>
|
1057 |
+
</tr>
|
1058 |
+
<tr>
|
1059 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
1060 |
+
<td>HC(001-038)</td>
|
1061 |
+
<td></td>
|
1062 |
+
<td>14.1%</td>
|
1063 |
+
<td>0.7%</td>
|
1064 |
+
</tr>
|
1065 |
+
</table>
|
1066 |
+
<hr>
|
1067 |
+
</div>
|
1068 |
+
|
1069 |
+
<div class="table-container">
|
1070 |
+
<h2>Table 27</h2>
|
1071 |
+
<table border="1">
|
1072 |
+
<tr>
|
1073 |
+
<td>Sequence</td>
|
1074 |
+
<td>Sequence location</td>
|
1075 |
+
<td>Modification</td>
|
1076 |
+
<td>Relative abundance</td>
|
1077 |
+
<td>Relative abundance</td>
|
1078 |
+
</tr>
|
1079 |
+
<tr>
|
1080 |
+
<td>Sequence</td>
|
1081 |
+
<td>Sequence location</td>
|
1082 |
+
<td>Modification</td>
|
1083 |
+
<td>L14-H12_T0</td>
|
1084 |
+
<td>L14-H12_T4w</td>
|
1085 |
+
</tr>
|
1086 |
+
<tr>
|
1087 |
+
<td>ASTSVTYMHWYQQKPGK</td>
|
1088 |
+
<td>LC(25-41)</td>
|
1089 |
+
<td>Ox. [+16 Da]</td>
|
1090 |
+
<td>0.3%</td>
|
1091 |
+
<td>0.3%</td>
|
1092 |
+
</tr>
|
1093 |
+
<tr>
|
1094 |
+
<td>ASTSVTYMHWYQQKPGK</td>
|
1095 |
+
<td>LC(25-41)</td>
|
1096 |
+
<td></td>
|
1097 |
+
<td>99.7%</td>
|
1098 |
+
<td>99.7%</td>
|
1099 |
+
</tr>
|
1100 |
+
</table>
|
1101 |
+
<hr>
|
1102 |
+
</div>
|
1103 |
+
|
1104 |
+
<div class="table-container">
|
1105 |
+
<h2>Table 28</h2>
|
1106 |
+
<table border="1">
|
1107 |
+
<tr>
|
1108 |
+
<td>Sequence</td>
|
1109 |
+
<td>Sequence location</td>
|
1110 |
+
<td>Modification</td>
|
1111 |
+
<td>Relative abundance</td>
|
1112 |
+
<td>Relative abundance</td>
|
1113 |
+
</tr>
|
1114 |
+
<tr>
|
1115 |
+
<td>Sequence</td>
|
1116 |
+
<td>Sequence location</td>
|
1117 |
+
<td>Modification</td>
|
1118 |
+
<td>L14-H12_T0</td>
|
1119 |
+
<td>L14-H12_T4w</td>
|
1120 |
+
</tr>
|
1121 |
+
<tr>
|
1122 |
+
<td>SSSNPLTFGAGTK</td>
|
1123 |
+
<td>LC (91-103)</td>
|
1124 |
+
<td></td>
|
1125 |
+
<td>99.9%</td>
|
1126 |
+
<td>99.4%</td>
|
1127 |
+
</tr>
|
1128 |
+
<tr>
|
1129 |
+
<td>SSSNPLTFGAGTK</td>
|
1130 |
+
<td>LC (91-103)</td>
|
1131 |
+
<td>deamidation</td>
|
1132 |
+
<td>0.1%</td>
|
1133 |
+
<td>0.6%</td>
|
1134 |
+
</tr>
|
1135 |
+
</table>
|
1136 |
+
<hr>
|
1137 |
+
</div>
|
1138 |
+
|
1139 |
+
<div class="table-container">
|
1140 |
+
<h2>Table 29</h2>
|
1141 |
+
<table border="1">
|
1142 |
+
<tr>
|
1143 |
+
<td>Sequence</td>
|
1144 |
+
<td>Sequence location</td>
|
1145 |
+
<td>Modification</td>
|
1146 |
+
<td>Relative abundance*</td>
|
1147 |
+
<td>Relative abundance*</td>
|
1148 |
+
</tr>
|
1149 |
+
<tr>
|
1150 |
+
<td>Sequence</td>
|
1151 |
+
<td>Sequence location</td>
|
1152 |
+
<td>Modification</td>
|
1153 |
+
<td>L14-H12_T0</td>
|
1154 |
+
<td>L14-H12_T4w</td>
|
1155 |
+
</tr>
|
1156 |
+
<tr>
|
1157 |
+
<td>STSGGTAALGCLVK</td>
|
1158 |
+
<td>HC (134-147)</td>
|
1159 |
+
<td></td>
|
1160 |
+
<td>99.9%</td>
|
1161 |
+
<td>98.9%</td>
|
1162 |
+
</tr>
|
1163 |
+
<tr>
|
1164 |
+
<td>GTAALGCLVK</td>
|
1165 |
+
<td>HC (134-147)</td>
|
1166 |
+
<td>Clipping</td>
|
1167 |
+
<td>0.1%</td>
|
1168 |
+
<td>1.1%</td>
|
1169 |
+
</tr>
|
1170 |
+
<tr>
|
1171 |
+
<td>SSSNPLTFGAGTK</td>
|
1172 |
+
<td>LC (91-103)</td>
|
1173 |
+
<td></td>
|
1174 |
+
<td>99.7%</td>
|
1175 |
+
<td>98.6%</td>
|
1176 |
+
</tr>
|
1177 |
+
<tr>
|
1178 |
+
<td>PLTFGAGTK</td>
|
1179 |
+
<td>LC (91-103)</td>
|
1180 |
+
<td>Clipping</td>
|
1181 |
+
<td>0.3%</td>
|
1182 |
+
<td>1.4%</td>
|
1183 |
+
</tr>
|
1184 |
+
</table>
|
1185 |
+
<hr>
|
1186 |
+
</div>
|
1187 |
+
|
1188 |
+
<div class="table-container">
|
1189 |
+
<h2>Table 30</h2>
|
1190 |
+
<table border="1">
|
1191 |
+
<tr>
|
1192 |
+
<td>Blue:</td>
|
1193 |
+
<td>VH and VL</td>
|
1194 |
+
</tr>
|
1195 |
+
<tr>
|
1196 |
+
<td>Blue:</td>
|
1197 |
+
<td>CDR</td>
|
1198 |
+
</tr>
|
1199 |
+
<tr>
|
1200 |
+
<td>Green:</td>
|
1201 |
+
<td>N-glycosylation site</td>
|
1202 |
+
</tr>
|
1203 |
+
</table>
|
1204 |
+
<hr>
|
1205 |
+
</div>
|
1206 |
+
|
1207 |
+
<div class="table-container">
|
1208 |
+
<h2>Table 31</h2>
|
1209 |
+
<table border="1">
|
1210 |
+
<tr>
|
1211 |
+
<td>Sequence</td>
|
1212 |
+
<td>Sequence location</td>
|
1213 |
+
<td>Modification</td>
|
1214 |
+
<td>Relative abundance</td>
|
1215 |
+
<td>Relative abundance</td>
|
1216 |
+
</tr>
|
1217 |
+
<tr>
|
1218 |
+
<td>Sequence</td>
|
1219 |
+
<td>Sequence location</td>
|
1220 |
+
<td>Modification</td>
|
1221 |
+
<td>L14-H31_T0</td>
|
1222 |
+
<td>L14-H31_T4w</td>
|
1223 |
+
</tr>
|
1224 |
+
<tr>
|
1225 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
1226 |
+
<td>HC(001-038)</td>
|
1227 |
+
<td>pyroQ</td>
|
1228 |
+
<td>82.6%</td>
|
1229 |
+
<td>100.0%</td>
|
1230 |
+
</tr>
|
1231 |
+
<tr>
|
1232 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
1233 |
+
<td>HC(001-038)</td>
|
1234 |
+
<td></td>
|
1235 |
+
<td>17.4%</td>
|
1236 |
+
<td>n.d</td>
|
1237 |
+
</tr>
|
1238 |
+
</table>
|
1239 |
+
<hr>
|
1240 |
+
</div>
|
1241 |
+
|
1242 |
+
<div class="table-container">
|
1243 |
+
<h2>Table 32</h2>
|
1244 |
+
<table border="1">
|
1245 |
+
<tr>
|
1246 |
+
<td>Sequence</td>
|
1247 |
+
<td>Sequence location</td>
|
1248 |
+
<td>Modification</td>
|
1249 |
+
<td>Relative abundance</td>
|
1250 |
+
<td>Relative abundance</td>
|
1251 |
+
</tr>
|
1252 |
+
<tr>
|
1253 |
+
<td>Sequence</td>
|
1254 |
+
<td>Sequence location</td>
|
1255 |
+
<td>Modification</td>
|
1256 |
+
<td>L14-H31_T0</td>
|
1257 |
+
<td>L14-H31_T4w</td>
|
1258 |
+
</tr>
|
1259 |
+
<tr>
|
1260 |
+
<td>ASTSVTYMHWYQQKPGK</td>
|
1261 |
+
<td>LC(25-41)</td>
|
1262 |
+
<td>Ox. [+16 Da]</td>
|
1263 |
+
<td>0.5%</td>
|
1264 |
+
<td>0.4%</td>
|
1265 |
+
</tr>
|
1266 |
+
<tr>
|
1267 |
+
<td>ASTSVTYMHWYQQKPGK</td>
|
1268 |
+
<td>LC(25-41)</td>
|
1269 |
+
<td></td>
|
1270 |
+
<td>99.5%</td>
|
1271 |
+
<td>99.6%</td>
|
1272 |
+
</tr>
|
1273 |
+
</table>
|
1274 |
+
<hr>
|
1275 |
+
</div>
|
1276 |
+
|
1277 |
+
<div class="table-container">
|
1278 |
+
<h2>Table 33</h2>
|
1279 |
+
<table border="1">
|
1280 |
+
<tr>
|
1281 |
+
<td>Sequence</td>
|
1282 |
+
<td>Sequence location</td>
|
1283 |
+
<td>Modification</td>
|
1284 |
+
<td>Relative abundance</td>
|
1285 |
+
<td>Relative abundance</td>
|
1286 |
+
</tr>
|
1287 |
+
<tr>
|
1288 |
+
<td>Sequence</td>
|
1289 |
+
<td>Sequence location</td>
|
1290 |
+
<td>Modification</td>
|
1291 |
+
<td>L14-H31_T0</td>
|
1292 |
+
<td>L14-H31_T4w</td>
|
1293 |
+
</tr>
|
1294 |
+
<tr>
|
1295 |
+
<td>SSSNPLTFGAGTK</td>
|
1296 |
+
<td>LC (91-103)</td>
|
1297 |
+
<td></td>
|
1298 |
+
<td>99.9%</td>
|
1299 |
+
<td>99.5%</td>
|
1300 |
+
</tr>
|
1301 |
+
<tr>
|
1302 |
+
<td>SSSNPLTFGAGTK</td>
|
1303 |
+
<td>LC (91-103)</td>
|
1304 |
+
<td>deamidation</td>
|
1305 |
+
<td>0.1%</td>
|
1306 |
+
<td>0.5%</td>
|
1307 |
+
</tr>
|
1308 |
+
</table>
|
1309 |
+
<hr>
|
1310 |
+
</div>
|
1311 |
+
|
1312 |
+
<div class="table-container">
|
1313 |
+
<h2>Table 34</h2>
|
1314 |
+
<table border="1">
|
1315 |
+
<tr>
|
1316 |
+
<td>Sequence</td>
|
1317 |
+
<td>Sequence location</td>
|
1318 |
+
<td>Modification</td>
|
1319 |
+
<td>Relative abundance*</td>
|
1320 |
+
<td>Relative abundance*</td>
|
1321 |
+
</tr>
|
1322 |
+
<tr>
|
1323 |
+
<td>Sequence</td>
|
1324 |
+
<td>Sequence location</td>
|
1325 |
+
<td>Modification</td>
|
1326 |
+
<td>L14-H31_T0</td>
|
1327 |
+
<td>L14-H31_T4w</td>
|
1328 |
+
</tr>
|
1329 |
+
<tr>
|
1330 |
+
<td>STSGGTAALGCLVK</td>
|
1331 |
+
<td>HC (134-147)</td>
|
1332 |
+
<td></td>
|
1333 |
+
<td>99.9%</td>
|
1334 |
+
<td>98.9%</td>
|
1335 |
+
</tr>
|
1336 |
+
<tr>
|
1337 |
+
<td>GTAALGCLVK</td>
|
1338 |
+
<td>HC (134-147)</td>
|
1339 |
+
<td>Clipping</td>
|
1340 |
+
<td>0.1%</td>
|
1341 |
+
<td>1.1%</td>
|
1342 |
+
</tr>
|
1343 |
+
<tr>
|
1344 |
+
<td>SSSNPLTFGAGTK</td>
|
1345 |
+
<td>LC (91-103)</td>
|
1346 |
+
<td></td>
|
1347 |
+
<td>99.7%</td>
|
1348 |
+
<td>98.4%</td>
|
1349 |
+
</tr>
|
1350 |
+
<tr>
|
1351 |
+
<td>PLTFGAGTK</td>
|
1352 |
+
<td>LC (91-103)</td>
|
1353 |
+
<td>Clipping</td>
|
1354 |
+
<td>0.3%</td>
|
1355 |
+
<td>1.6%</td>
|
1356 |
+
</tr>
|
1357 |
+
</table>
|
1358 |
+
<hr>
|
1359 |
+
</div>
|
1360 |
+
|
1361 |
+
<div class="table-container">
|
1362 |
+
<h2>Table 35</h2>
|
1363 |
+
<table border="1">
|
1364 |
+
<tr>
|
1365 |
+
<td>Blue:</td>
|
1366 |
+
<td>VH and VL</td>
|
1367 |
+
</tr>
|
1368 |
+
<tr>
|
1369 |
+
<td>Blue:</td>
|
1370 |
+
<td>CDR</td>
|
1371 |
+
</tr>
|
1372 |
+
<tr>
|
1373 |
+
<td>Green:</td>
|
1374 |
+
<td>N-glycosylation site</td>
|
1375 |
+
</tr>
|
1376 |
+
</table>
|
1377 |
+
<hr>
|
1378 |
+
</div>
|
1379 |
+
|
1380 |
+
<div class="table-container">
|
1381 |
+
<h2>Table 36</h2>
|
1382 |
+
<table border="1">
|
1383 |
+
<tr>
|
1384 |
+
<td>Nathan Cardon</td>
|
1385 |
+
<td>Date:</td>
|
1386 |
+
</tr>
|
1387 |
+
<tr>
|
1388 |
+
<td>Sr Research Associate</td>
|
1389 |
+
<td>Signature:</td>
|
1390 |
+
</tr>
|
1391 |
+
<tr>
|
1392 |
+
<td>Mabelle Meersseman</td>
|
1393 |
+
<td>Date:</td>
|
1394 |
+
</tr>
|
1395 |
+
<tr>
|
1396 |
+
<td>Group Leader</td>
|
1397 |
+
<td>Signature:</td>
|
1398 |
+
</tr>
|
1399 |
+
<tr>
|
1400 |
+
<td>Approver</td>
|
1401 |
+
<td></td>
|
1402 |
+
</tr>
|
1403 |
+
<tr>
|
1404 |
+
<td>Koen Sandra Ph.D.</td>
|
1405 |
+
<td>Date:</td>
|
1406 |
+
</tr>
|
1407 |
+
<tr>
|
1408 |
+
<td>CEO</td>
|
1409 |
+
<td>Signature:</td>
|
1410 |
+
</tr>
|
1411 |
+
</table>
|
1412 |
+
<hr>
|
1413 |
+
</div>
|
1414 |
+
|
1415 |
+
<div class="table-container">
|
1416 |
+
<h2>Table 37</h2>
|
1417 |
+
<table border="1">
|
1418 |
+
<tr>
|
1419 |
+
<td>Version</td>
|
1420 |
+
<td>Date of issue</td>
|
1421 |
+
<td>Reason for version update</td>
|
1422 |
+
</tr>
|
1423 |
+
<tr>
|
1424 |
+
<td>00</td>
|
1425 |
+
<td>25NOV24</td>
|
1426 |
+
<td>Draft</td>
|
1427 |
+
</tr>
|
1428 |
+
<tr>
|
1429 |
+
<td></td>
|
1430 |
+
<td></td>
|
1431 |
+
<td></td>
|
1432 |
+
</tr>
|
1433 |
+
<tr>
|
1434 |
+
<td></td>
|
1435 |
+
<td></td>
|
1436 |
+
<td></td>
|
1437 |
+
</tr>
|
1438 |
+
</table>
|
1439 |
+
<hr>
|
1440 |
+
</div>
|
1441 |
+
</body></html>
|
logs/di_content/di_content_20250618_143852_tables.html
ADDED
@@ -0,0 +1,1441 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
1 |
+
<!DOCTYPE html>
|
2 |
+
<html>
|
3 |
+
<head>
|
4 |
+
<title>Azure DI Tables</title>
|
5 |
+
<style>
|
6 |
+
body { font-family: Arial, sans-serif; margin: 20px; }
|
7 |
+
.table-container { margin-bottom: 40px; }
|
8 |
+
h2 { color: #333; }
|
9 |
+
table { border-collapse: collapse; width: 100%; margin-bottom: 10px; }
|
10 |
+
th, td { border: 1px solid #ddd; padding: 8px; text-align: left; }
|
11 |
+
th { background-color: #f5f5f5; }
|
12 |
+
hr { border: none; border-top: 2px solid #ccc; margin: 20px 0; }
|
13 |
+
</style>
|
14 |
+
</head>
|
15 |
+
<body>
|
16 |
+
<h1>Azure Document Intelligence Tables</h1>
|
17 |
+
|
18 |
+
<div class="table-container">
|
19 |
+
<h2>Table 1</h2>
|
20 |
+
<table border="1">
|
21 |
+
<tr>
|
22 |
+
<td>l Sales quote:</td>
|
23 |
+
<td>SQ20202722</td>
|
24 |
+
</tr>
|
25 |
+
<tr>
|
26 |
+
<td>l Project code:</td>
|
27 |
+
<td>P3016</td>
|
28 |
+
</tr>
|
29 |
+
<tr>
|
30 |
+
<td>l LNB number:</td>
|
31 |
+
<td>2023.050</td>
|
32 |
+
</tr>
|
33 |
+
<tr>
|
34 |
+
<td>l Project responsible:</td>
|
35 |
+
<td>Nathan Cardon</td>
|
36 |
+
</tr>
|
37 |
+
<tr>
|
38 |
+
<td>l Report name:</td>
|
39 |
+
<td>P3016_R11_v00</td>
|
40 |
+
</tr>
|
41 |
+
</table>
|
42 |
+
<hr>
|
43 |
+
</div>
|
44 |
+
|
45 |
+
<div class="table-container">
|
46 |
+
<h2>Table 2</h2>
|
47 |
+
<table border="1">
|
48 |
+
<tr>
|
49 |
+
<td>Test sample ID client</td>
|
50 |
+
<td>Test sample ID RIC</td>
|
51 |
+
<td>Protein concentration (mg/ML)</td>
|
52 |
+
</tr>
|
53 |
+
<tr>
|
54 |
+
<td>P066_FH0.7-0-hulgG-LALAPG-FJB</td>
|
55 |
+
<td>aFH0.7_T0</td>
|
56 |
+
<td>1.0</td>
|
57 |
+
</tr>
|
58 |
+
<tr>
|
59 |
+
<td>P066_FH0.7-0-hulgG-LALAPG-FJB</td>
|
60 |
+
<td>aFH.07_T4W</td>
|
61 |
+
<td>1.0</td>
|
62 |
+
</tr>
|
63 |
+
<tr>
|
64 |
+
<td>P066_FHR-1.3B4_0-hulgG-LALAPG-FJB</td>
|
65 |
+
<td>FHR-1.3B4_T0</td>
|
66 |
+
<td>1.0</td>
|
67 |
+
</tr>
|
68 |
+
<tr>
|
69 |
+
<td>P066_FHR-1.3B4_0-hulgG-LALAPG-FJB</td>
|
70 |
+
<td>FHR-1.3B4_T4W</td>
|
71 |
+
<td>1.0</td>
|
72 |
+
</tr>
|
73 |
+
<tr>
|
74 |
+
<td>P066_L5_H12_0-hulgG-LALAPG-FJB</td>
|
75 |
+
<td>L5_H12_T0</td>
|
76 |
+
<td>1.0</td>
|
77 |
+
</tr>
|
78 |
+
<tr>
|
79 |
+
<td>P066_L5_H12_0-hulgG-LALAPG-FJB</td>
|
80 |
+
<td>L5_H12_T4W</td>
|
81 |
+
<td>1.0</td>
|
82 |
+
</tr>
|
83 |
+
<tr>
|
84 |
+
<td>P066_L5_H31-0-hulgG-LALAPG-FJB</td>
|
85 |
+
<td>L5_H31_T0</td>
|
86 |
+
<td>1.0</td>
|
87 |
+
</tr>
|
88 |
+
<tr>
|
89 |
+
<td>P066_L5_H31-0-hulgG-LALAPG-FJB</td>
|
90 |
+
<td>L5_H31_T4W</td>
|
91 |
+
<td>1.0</td>
|
92 |
+
</tr>
|
93 |
+
<tr>
|
94 |
+
<td>P066_L14_H12_0-hulgG-LALAPG-FJB</td>
|
95 |
+
<td>L14_H12_T0</td>
|
96 |
+
<td>1.0</td>
|
97 |
+
</tr>
|
98 |
+
<tr>
|
99 |
+
<td>P066_L14_H12_0-hulgG-LALAPG-FJB</td>
|
100 |
+
<td>L14_H12_T4W</td>
|
101 |
+
<td>1.0</td>
|
102 |
+
</tr>
|
103 |
+
<tr>
|
104 |
+
<td>P066_L14_H31_0-hulgG-LALAPG-FJB</td>
|
105 |
+
<td>L14_H31_T0</td>
|
106 |
+
<td>1.0</td>
|
107 |
+
</tr>
|
108 |
+
<tr>
|
109 |
+
<td>P066_L14_H31_0-hulgG-LALAPG-FJB</td>
|
110 |
+
<td>L14-H31_T4W</td>
|
111 |
+
<td>1.0</td>
|
112 |
+
</tr>
|
113 |
+
</table>
|
114 |
+
<hr>
|
115 |
+
</div>
|
116 |
+
|
117 |
+
<div class="table-container">
|
118 |
+
<h2>Table 3</h2>
|
119 |
+
<table border="1">
|
120 |
+
<tr>
|
121 |
+
<td></td>
|
122 |
+
<td>aFH.07_T0</td>
|
123 |
+
<td>aFH.07_T4W</td>
|
124 |
+
</tr>
|
125 |
+
<tr>
|
126 |
+
<td>G0-GlcNAc</td>
|
127 |
+
<td>5.0%</td>
|
128 |
+
<td>4.5%</td>
|
129 |
+
</tr>
|
130 |
+
<tr>
|
131 |
+
<td>Man5</td>
|
132 |
+
<td>56.1%</td>
|
133 |
+
<td>56.3%</td>
|
134 |
+
</tr>
|
135 |
+
<tr>
|
136 |
+
<td>Man6</td>
|
137 |
+
<td>17.6%</td>
|
138 |
+
<td>17.4%</td>
|
139 |
+
</tr>
|
140 |
+
<tr>
|
141 |
+
<td>Man7</td>
|
142 |
+
<td>20.7%</td>
|
143 |
+
<td>21.6%</td>
|
144 |
+
</tr>
|
145 |
+
<tr>
|
146 |
+
<td>Man8</td>
|
147 |
+
<td>0.6%</td>
|
148 |
+
<td>0.2%</td>
|
149 |
+
</tr>
|
150 |
+
</table>
|
151 |
+
<hr>
|
152 |
+
</div>
|
153 |
+
|
154 |
+
<div class="table-container">
|
155 |
+
<h2>Table 4</h2>
|
156 |
+
<table border="1">
|
157 |
+
<tr>
|
158 |
+
<td></td>
|
159 |
+
<td>aFH.07_T0</td>
|
160 |
+
<td>aFH.07_T4W</td>
|
161 |
+
</tr>
|
162 |
+
<tr>
|
163 |
+
<td>Unknown peak</td>
|
164 |
+
<td>0.6%</td>
|
165 |
+
<td>1.3%</td>
|
166 |
+
</tr>
|
167 |
+
<tr>
|
168 |
+
<td>HC [G0F/G0] - 2*GlcNAc</td>
|
169 |
+
<td>1.5%</td>
|
170 |
+
<td>2.0%</td>
|
171 |
+
</tr>
|
172 |
+
<tr>
|
173 |
+
<td>HC [Man5-Man5]</td>
|
174 |
+
<td>16.7%</td>
|
175 |
+
<td>16.5%</td>
|
176 |
+
</tr>
|
177 |
+
<tr>
|
178 |
+
<td>HC [G0F-Man5]</td>
|
179 |
+
<td>10.9%</td>
|
180 |
+
<td>11.9%</td>
|
181 |
+
</tr>
|
182 |
+
<tr>
|
183 |
+
<td>HC [G0F/G0] - GlcNAc</td>
|
184 |
+
<td>16.5%</td>
|
185 |
+
<td>17.2%</td>
|
186 |
+
</tr>
|
187 |
+
<tr>
|
188 |
+
<td>HC [G0F/G0]</td>
|
189 |
+
<td>6.5%</td>
|
190 |
+
<td>6.0%</td>
|
191 |
+
</tr>
|
192 |
+
<tr>
|
193 |
+
<td>HC [G0F/G0F]</td>
|
194 |
+
<td>35.5%</td>
|
195 |
+
<td>33.8%</td>
|
196 |
+
</tr>
|
197 |
+
<tr>
|
198 |
+
<td>HC [G0F/G1F]</td>
|
199 |
+
<td>6.5%</td>
|
200 |
+
<td>5.9%</td>
|
201 |
+
</tr>
|
202 |
+
<tr>
|
203 |
+
<td>HC [G1F/G1F] or HC [G0F/G2F]</td>
|
204 |
+
<td>5.0%</td>
|
205 |
+
<td>4.8%</td>
|
206 |
+
</tr>
|
207 |
+
<tr>
|
208 |
+
<td>HC [G1F/G2F]</td>
|
209 |
+
<td>0.3%</td>
|
210 |
+
<td>0.6%</td>
|
211 |
+
</tr>
|
212 |
+
</table>
|
213 |
+
<hr>
|
214 |
+
</div>
|
215 |
+
|
216 |
+
<div class="table-container">
|
217 |
+
<h2>Table 5</h2>
|
218 |
+
<table border="1">
|
219 |
+
<tr>
|
220 |
+
<td>Sequence</td>
|
221 |
+
<td>Sequence location</td>
|
222 |
+
<td>Modification</td>
|
223 |
+
<td>Relative abundance</td>
|
224 |
+
<td>Relative abundance</td>
|
225 |
+
</tr>
|
226 |
+
<tr>
|
227 |
+
<td>Sequence</td>
|
228 |
+
<td>Sequence location</td>
|
229 |
+
<td>Modification</td>
|
230 |
+
<td>aFH.07_T0</td>
|
231 |
+
<td>aFH.07_T4W</td>
|
232 |
+
</tr>
|
233 |
+
<tr>
|
234 |
+
<td>QIVLSQSPTFLSASPGEK</td>
|
235 |
+
<td>LC (001-018)</td>
|
236 |
+
<td>pyroQ</td>
|
237 |
+
<td>86.8%</td>
|
238 |
+
<td>99.7%</td>
|
239 |
+
</tr>
|
240 |
+
<tr>
|
241 |
+
<td>QIVLSQSPTFLSASPGEK</td>
|
242 |
+
<td>LC (001-018)</td>
|
243 |
+
<td></td>
|
244 |
+
<td>13.2%</td>
|
245 |
+
<td>0.3%</td>
|
246 |
+
</tr>
|
247 |
+
<tr>
|
248 |
+
<td>QVQLQQSGPGLVQPSQSLSITCTVSDFSLAR</td>
|
249 |
+
<td>HC (001-031)</td>
|
250 |
+
<td>pyroQ</td>
|
251 |
+
<td>90.0%</td>
|
252 |
+
<td>100.0%</td>
|
253 |
+
</tr>
|
254 |
+
<tr>
|
255 |
+
<td>QVQLQQSGPGLVQPSQSLSITCTVSDFSLAR</td>
|
256 |
+
<td>HC (001-031)</td>
|
257 |
+
<td></td>
|
258 |
+
<td>10.0%</td>
|
259 |
+
<td>n.d</td>
|
260 |
+
</tr>
|
261 |
+
</table>
|
262 |
+
<hr>
|
263 |
+
</div>
|
264 |
+
|
265 |
+
<div class="table-container">
|
266 |
+
<h2>Table 6</h2>
|
267 |
+
<table border="1">
|
268 |
+
<tr>
|
269 |
+
<td>Sequence</td>
|
270 |
+
<td>Sequence location</td>
|
271 |
+
<td>Modification</td>
|
272 |
+
<td>Relative abundance</td>
|
273 |
+
<td>Relative abundance</td>
|
274 |
+
</tr>
|
275 |
+
<tr>
|
276 |
+
<td>Sequence</td>
|
277 |
+
<td>Sequence location</td>
|
278 |
+
<td>Modification</td>
|
279 |
+
<td>aFH.07_T0</td>
|
280 |
+
<td>aFH.07_T4W</td>
|
281 |
+
</tr>
|
282 |
+
<tr>
|
283 |
+
<td>YMHWYQQKPGASPKPWIFATSNLASGVPAR</td>
|
284 |
+
<td>LC (31-60)</td>
|
285 |
+
<td>Oxidation [+16 Da]</td>
|
286 |
+
<td>0.9%</td>
|
287 |
+
<td>1.0%</td>
|
288 |
+
</tr>
|
289 |
+
<tr>
|
290 |
+
<td>YMHWYQQKPGASPKPWIFATSNLASGVPAR</td>
|
291 |
+
<td>LC (31-60)</td>
|
292 |
+
<td></td>
|
293 |
+
<td>99.1%</td>
|
294 |
+
<td>99.0%</td>
|
295 |
+
</tr>
|
296 |
+
</table>
|
297 |
+
<hr>
|
298 |
+
</div>
|
299 |
+
|
300 |
+
<div class="table-container">
|
301 |
+
<h2>Table 7</h2>
|
302 |
+
<table border="1">
|
303 |
+
<tr>
|
304 |
+
<td>Sequence</td>
|
305 |
+
<td>Sequence location</td>
|
306 |
+
<td>Modification</td>
|
307 |
+
<td>Relative abundance</td>
|
308 |
+
<td>Relative abundance</td>
|
309 |
+
</tr>
|
310 |
+
<tr>
|
311 |
+
<td>Sequence</td>
|
312 |
+
<td>Sequence location</td>
|
313 |
+
<td>Modification</td>
|
314 |
+
<td>aFH.07_T0</td>
|
315 |
+
<td>aFH.07_T4W</td>
|
316 |
+
</tr>
|
317 |
+
<tr>
|
318 |
+
<td>LNINKDNSK</td>
|
319 |
+
<td>HC (72-75)</td>
|
320 |
+
<td></td>
|
321 |
+
<td>99.5%</td>
|
322 |
+
<td>98.9%</td>
|
323 |
+
</tr>
|
324 |
+
<tr>
|
325 |
+
<td>LNINKDNSK</td>
|
326 |
+
<td>HC (72-75)</td>
|
327 |
+
<td>Deamidation</td>
|
328 |
+
<td>0.5%</td>
|
329 |
+
<td>1.1%</td>
|
330 |
+
</tr>
|
331 |
+
</table>
|
332 |
+
<hr>
|
333 |
+
</div>
|
334 |
+
|
335 |
+
<div class="table-container">
|
336 |
+
<h2>Table 8</h2>
|
337 |
+
<table border="1">
|
338 |
+
<tr>
|
339 |
+
<td>Sequence</td>
|
340 |
+
<td>Sequence location</td>
|
341 |
+
<td>Modification</td>
|
342 |
+
<td>Relative abundance</td>
|
343 |
+
<td>Relative abundance</td>
|
344 |
+
</tr>
|
345 |
+
<tr>
|
346 |
+
<td>Sequence</td>
|
347 |
+
<td>Sequence location</td>
|
348 |
+
<td>Modification</td>
|
349 |
+
<td>aFH.07_T0</td>
|
350 |
+
<td>aFH.07_T4W</td>
|
351 |
+
</tr>
|
352 |
+
<tr>
|
353 |
+
<td>VEAEDAATYYCQQWSIIPPTFGNGTK</td>
|
354 |
+
<td>LC (77-102)</td>
|
355 |
+
<td>GO-GICNAc</td>
|
356 |
+
<td>2.6%</td>
|
357 |
+
<td>4.0%</td>
|
358 |
+
</tr>
|
359 |
+
<tr>
|
360 |
+
<td>VEAEDAATYYCQQWSIIPPTFGNGTK</td>
|
361 |
+
<td>LC (77-102)</td>
|
362 |
+
<td>Man5</td>
|
363 |
+
<td>54.9%</td>
|
364 |
+
<td>57.3%</td>
|
365 |
+
</tr>
|
366 |
+
<tr>
|
367 |
+
<td>VEAEDAATYYCQQWSIIPPTFGNGTK</td>
|
368 |
+
<td>LC (77-102)</td>
|
369 |
+
<td>Man6</td>
|
370 |
+
<td>21.1%</td>
|
371 |
+
<td>18.8%</td>
|
372 |
+
</tr>
|
373 |
+
<tr>
|
374 |
+
<td>VEAEDAATYYCQQWSIIPPTFGNGTK</td>
|
375 |
+
<td>LC (77-102)</td>
|
376 |
+
<td>Man7</td>
|
377 |
+
<td>21.4%</td>
|
378 |
+
<td>20.0%</td>
|
379 |
+
</tr>
|
380 |
+
</table>
|
381 |
+
<hr>
|
382 |
+
</div>
|
383 |
+
|
384 |
+
<div class="table-container">
|
385 |
+
<h2>Table 9</h2>
|
386 |
+
<table border="1">
|
387 |
+
<tr>
|
388 |
+
<td>Sequence</td>
|
389 |
+
<td>Sequence location</td>
|
390 |
+
<td>Modification</td>
|
391 |
+
<td>Relative abundance</td>
|
392 |
+
<td>Relative abundance</td>
|
393 |
+
</tr>
|
394 |
+
<tr>
|
395 |
+
<td>Sequence</td>
|
396 |
+
<td>Sequence location</td>
|
397 |
+
<td>Modification</td>
|
398 |
+
<td>aFH.07_T0</td>
|
399 |
+
<td>aFH.07_T4W</td>
|
400 |
+
</tr>
|
401 |
+
<tr>
|
402 |
+
<td>MNSLQANDTAIYYCAR</td>
|
403 |
+
<td>HC (82-97)</td>
|
404 |
+
<td>Non glycosylated</td>
|
405 |
+
<td>n.d</td>
|
406 |
+
<td>n.d</td>
|
407 |
+
</tr>
|
408 |
+
<tr>
|
409 |
+
<td>MNSLQANDTAIYYCAR</td>
|
410 |
+
<td>HC (82-97)</td>
|
411 |
+
<td>G0F-GlcNAc</td>
|
412 |
+
<td>16.3%</td>
|
413 |
+
<td>20.8%</td>
|
414 |
+
</tr>
|
415 |
+
<tr>
|
416 |
+
<td>MNSLQANDTAIYYCAR</td>
|
417 |
+
<td>HC (82-97)</td>
|
418 |
+
<td>G0</td>
|
419 |
+
<td>4.2%</td>
|
420 |
+
<td>3.7%</td>
|
421 |
+
</tr>
|
422 |
+
<tr>
|
423 |
+
<td>MNSLQANDTAIYYCAR</td>
|
424 |
+
<td>HC (82-97)</td>
|
425 |
+
<td>G0F</td>
|
426 |
+
<td>36.5%</td>
|
427 |
+
<td>34.0%</td>
|
428 |
+
</tr>
|
429 |
+
<tr>
|
430 |
+
<td>MNSLQANDTAIYYCAR</td>
|
431 |
+
<td>HC (82-97)</td>
|
432 |
+
<td>G1F</td>
|
433 |
+
<td>4.9%</td>
|
434 |
+
<td>5.1%</td>
|
435 |
+
</tr>
|
436 |
+
<tr>
|
437 |
+
<td>MNSLQANDTAIYYCAR</td>
|
438 |
+
<td>HC (82-97)</td>
|
439 |
+
<td>G2F</td>
|
440 |
+
<td>5.7%</td>
|
441 |
+
<td>4.8%</td>
|
442 |
+
</tr>
|
443 |
+
<tr>
|
444 |
+
<td>MNSLQANDTAIYYCAR</td>
|
445 |
+
<td>HC (82-97)</td>
|
446 |
+
<td>Man5</td>
|
447 |
+
<td>32.4%</td>
|
448 |
+
<td>31.5%</td>
|
449 |
+
</tr>
|
450 |
+
</table>
|
451 |
+
<hr>
|
452 |
+
</div>
|
453 |
+
|
454 |
+
<div class="table-container">
|
455 |
+
<h2>Table 10</h2>
|
456 |
+
<table border="1">
|
457 |
+
<tr>
|
458 |
+
<td>Sequence</td>
|
459 |
+
<td>Sequence location</td>
|
460 |
+
<td>Modification</td>
|
461 |
+
<td>Relative abundance</td>
|
462 |
+
<td>Relative abundance</td>
|
463 |
+
</tr>
|
464 |
+
<tr>
|
465 |
+
<td>Sequence</td>
|
466 |
+
<td>Sequence location</td>
|
467 |
+
<td>Modification</td>
|
468 |
+
<td>aFH.07_T0</td>
|
469 |
+
<td>aFH.07_T4W</td>
|
470 |
+
</tr>
|
471 |
+
<tr>
|
472 |
+
<td>EEQYNSTYR</td>
|
473 |
+
<td>HC (293-301)</td>
|
474 |
+
<td>Non glycosylated</td>
|
475 |
+
<td>n.d</td>
|
476 |
+
<td>n.d</td>
|
477 |
+
</tr>
|
478 |
+
<tr>
|
479 |
+
<td>EEQYNSTYR</td>
|
480 |
+
<td>HC (293-301)</td>
|
481 |
+
<td>Man5</td>
|
482 |
+
<td>20.9%</td>
|
483 |
+
<td>22.5%</td>
|
484 |
+
</tr>
|
485 |
+
<tr>
|
486 |
+
<td>EEQYNSTYR</td>
|
487 |
+
<td>HC (293-301)</td>
|
488 |
+
<td>G0</td>
|
489 |
+
<td>n.D</td>
|
490 |
+
<td>n.d</td>
|
491 |
+
</tr>
|
492 |
+
<tr>
|
493 |
+
<td>EEQYNSTYR</td>
|
494 |
+
<td>HC (293-301)</td>
|
495 |
+
<td>G0F</td>
|
496 |
+
<td>79.1%</td>
|
497 |
+
<td>77.5%</td>
|
498 |
+
</tr>
|
499 |
+
<tr>
|
500 |
+
<td>EEQYNSTYR</td>
|
501 |
+
<td>HC (293-301)</td>
|
502 |
+
<td>G1F</td>
|
503 |
+
<td>n.d</td>
|
504 |
+
<td>n.d</td>
|
505 |
+
</tr>
|
506 |
+
<tr>
|
507 |
+
<td>EEQYNSTYR</td>
|
508 |
+
<td>HC (293-301)</td>
|
509 |
+
<td>G2F</td>
|
510 |
+
<td>n.d</td>
|
511 |
+
<td>n.d</td>
|
512 |
+
</tr>
|
513 |
+
</table>
|
514 |
+
<hr>
|
515 |
+
</div>
|
516 |
+
|
517 |
+
<div class="table-container">
|
518 |
+
<h2>Table 11</h2>
|
519 |
+
<table border="1">
|
520 |
+
<tr>
|
521 |
+
<td>Sequence</td>
|
522 |
+
<td>Sequence location</td>
|
523 |
+
<td>Modification</td>
|
524 |
+
<td>Relative abundance*</td>
|
525 |
+
<td>Relative abundance*</td>
|
526 |
+
</tr>
|
527 |
+
<tr>
|
528 |
+
<td>Sequence</td>
|
529 |
+
<td>Sequence location</td>
|
530 |
+
<td>Modification</td>
|
531 |
+
<td>aFH.07_T0</td>
|
532 |
+
<td>aFH.07_T4W</td>
|
533 |
+
</tr>
|
534 |
+
<tr>
|
535 |
+
<td>STSGGTAALGCLVK</td>
|
536 |
+
<td>HC (134-147)</td>
|
537 |
+
<td></td>
|
538 |
+
<td>99.9%</td>
|
539 |
+
<td>98.8%</td>
|
540 |
+
</tr>
|
541 |
+
<tr>
|
542 |
+
<td>GTAALGCLVK</td>
|
543 |
+
<td>HC (134-147)</td>
|
544 |
+
<td>Clipping</td>
|
545 |
+
<td>0.1%</td>
|
546 |
+
<td>1.2%</td>
|
547 |
+
</tr>
|
548 |
+
</table>
|
549 |
+
<hr>
|
550 |
+
</div>
|
551 |
+
|
552 |
+
<div class="table-container">
|
553 |
+
<h2>Table 12</h2>
|
554 |
+
<table border="1">
|
555 |
+
<tr>
|
556 |
+
<td>Blue:</td>
|
557 |
+
<td>VH and VL</td>
|
558 |
+
</tr>
|
559 |
+
<tr>
|
560 |
+
<td>Blue:</td>
|
561 |
+
<td>CDR</td>
|
562 |
+
</tr>
|
563 |
+
<tr>
|
564 |
+
<td>Green:</td>
|
565 |
+
<td>N-glycosylation site</td>
|
566 |
+
</tr>
|
567 |
+
</table>
|
568 |
+
<hr>
|
569 |
+
</div>
|
570 |
+
|
571 |
+
<div class="table-container">
|
572 |
+
<h2>Table 13</h2>
|
573 |
+
<table border="1">
|
574 |
+
<tr>
|
575 |
+
<td>Sequence</td>
|
576 |
+
<td>Sequence location</td>
|
577 |
+
<td>Modification</td>
|
578 |
+
<td>Relative abundance</td>
|
579 |
+
<td>Relative abundance</td>
|
580 |
+
</tr>
|
581 |
+
<tr>
|
582 |
+
<td>Sequence</td>
|
583 |
+
<td>Sequence location</td>
|
584 |
+
<td>Modification</td>
|
585 |
+
<td>FHR-1.3B4_T0</td>
|
586 |
+
<td>FHR-1.3B4_T4W</td>
|
587 |
+
</tr>
|
588 |
+
<tr>
|
589 |
+
<td>QIVLSQSPTILSASPGEK</td>
|
590 |
+
<td>LC (1-18)</td>
|
591 |
+
<td>pyro Q</td>
|
592 |
+
<td>96.1%</td>
|
593 |
+
<td>100.0%</td>
|
594 |
+
</tr>
|
595 |
+
<tr>
|
596 |
+
<td>QIVLSQSPTILSASPGEK</td>
|
597 |
+
<td>LC (1-18)</td>
|
598 |
+
<td></td>
|
599 |
+
<td>3.9%</td>
|
600 |
+
<td>n.d</td>
|
601 |
+
</tr>
|
602 |
+
<tr>
|
603 |
+
<td>QVQLR</td>
|
604 |
+
<td>HC (1-5)</td>
|
605 |
+
<td>pyro Q</td>
|
606 |
+
<td>96.7%</td>
|
607 |
+
<td>100.0%</td>
|
608 |
+
</tr>
|
609 |
+
<tr>
|
610 |
+
<td>QVQLR</td>
|
611 |
+
<td>HC (1-5)</td>
|
612 |
+
<td></td>
|
613 |
+
<td>3.3%</td>
|
614 |
+
<td>n.d</td>
|
615 |
+
</tr>
|
616 |
+
</table>
|
617 |
+
<hr>
|
618 |
+
</div>
|
619 |
+
|
620 |
+
<div class="table-container">
|
621 |
+
<h2>Table 14</h2>
|
622 |
+
<table border="1">
|
623 |
+
<tr>
|
624 |
+
<td>Sequence</td>
|
625 |
+
<td>Sequence location</td>
|
626 |
+
<td>Modification</td>
|
627 |
+
<td>Relative abundance</td>
|
628 |
+
<td>Relative abundance</td>
|
629 |
+
</tr>
|
630 |
+
<tr>
|
631 |
+
<td>Sequence</td>
|
632 |
+
<td>Sequence location</td>
|
633 |
+
<td>Modification</td>
|
634 |
+
<td>FHR-1.3B4_T0</td>
|
635 |
+
<td>FHR-1.3B4_T4W</td>
|
636 |
+
</tr>
|
637 |
+
<tr>
|
638 |
+
<td>MNSLQADDTAIYYCAR</td>
|
639 |
+
<td>HC (82-97)</td>
|
640 |
+
<td></td>
|
641 |
+
<td>99.3%</td>
|
642 |
+
<td>99.0%</td>
|
643 |
+
</tr>
|
644 |
+
<tr>
|
645 |
+
<td>MNSLQADDTAIYYCAR</td>
|
646 |
+
<td>HC (82-97)</td>
|
647 |
+
<td>Ox [+ 16 Da]</td>
|
648 |
+
<td>0.7%</td>
|
649 |
+
<td>1.0%</td>
|
650 |
+
</tr>
|
651 |
+
</table>
|
652 |
+
<hr>
|
653 |
+
</div>
|
654 |
+
|
655 |
+
<div class="table-container">
|
656 |
+
<h2>Table 15</h2>
|
657 |
+
<table border="1">
|
658 |
+
<tr>
|
659 |
+
<td>Sequence</td>
|
660 |
+
<td>Sequence location</td>
|
661 |
+
<td>Modification</td>
|
662 |
+
<td>Relative abundance</td>
|
663 |
+
<td>Relative abundance</td>
|
664 |
+
</tr>
|
665 |
+
<tr>
|
666 |
+
<td>Sequence</td>
|
667 |
+
<td>Sequence location</td>
|
668 |
+
<td>Modification</td>
|
669 |
+
<td>FHR-1.3B4_T0</td>
|
670 |
+
<td>FHR-1.3B4_T4W</td>
|
671 |
+
</tr>
|
672 |
+
<tr>
|
673 |
+
<td>MNSLQADDTAIYYCAR</td>
|
674 |
+
<td>HC (82-97)</td>
|
675 |
+
<td></td>
|
676 |
+
<td>97.6%</td>
|
677 |
+
<td>79.7%</td>
|
678 |
+
</tr>
|
679 |
+
<tr>
|
680 |
+
<td>MNSLQADDTAIYYCAR</td>
|
681 |
+
<td>HC (82-97)</td>
|
682 |
+
<td>Deamidation</td>
|
683 |
+
<td>2.4%</td>
|
684 |
+
<td>20.3%</td>
|
685 |
+
</tr>
|
686 |
+
</table>
|
687 |
+
<hr>
|
688 |
+
</div>
|
689 |
+
|
690 |
+
<div class="table-container">
|
691 |
+
<h2>Table 16</h2>
|
692 |
+
<table border="1">
|
693 |
+
<tr>
|
694 |
+
<td>Sequence</td>
|
695 |
+
<td>Sequence location</td>
|
696 |
+
<td>Modification</td>
|
697 |
+
<td>Relative abundance*</td>
|
698 |
+
<td>Relative abundance*</td>
|
699 |
+
</tr>
|
700 |
+
<tr>
|
701 |
+
<td>Sequence</td>
|
702 |
+
<td>Sequence location</td>
|
703 |
+
<td>Modification</td>
|
704 |
+
<td>FHR-1.3B4_T0</td>
|
705 |
+
<td>FHR-1.3B4_T4W</td>
|
706 |
+
</tr>
|
707 |
+
<tr>
|
708 |
+
<td>STSGGTAALGCLVK</td>
|
709 |
+
<td>HC (134-147)</td>
|
710 |
+
<td></td>
|
711 |
+
<td>99.9%</td>
|
712 |
+
<td>98.7%</td>
|
713 |
+
</tr>
|
714 |
+
<tr>
|
715 |
+
<td>GTAALGCLVK</td>
|
716 |
+
<td>HC (134-147)</td>
|
717 |
+
<td>Clipping</td>
|
718 |
+
<td>0.1%</td>
|
719 |
+
<td>1.3%</td>
|
720 |
+
</tr>
|
721 |
+
<tr>
|
722 |
+
<td>SSSNPLTFGAGTK</td>
|
723 |
+
<td>LC (91-103)</td>
|
724 |
+
<td></td>
|
725 |
+
<td>99.5%</td>
|
726 |
+
<td>97.3%</td>
|
727 |
+
</tr>
|
728 |
+
<tr>
|
729 |
+
<td>PLTFGAGTK</td>
|
730 |
+
<td>LC (91-103)</td>
|
731 |
+
<td>Clipping</td>
|
732 |
+
<td>0.5%</td>
|
733 |
+
<td>2.7%</td>
|
734 |
+
</tr>
|
735 |
+
</table>
|
736 |
+
<hr>
|
737 |
+
</div>
|
738 |
+
|
739 |
+
<div class="table-container">
|
740 |
+
<h2>Table 17</h2>
|
741 |
+
<table border="1">
|
742 |
+
<tr>
|
743 |
+
<td>Blue:</td>
|
744 |
+
<td>VH and VL</td>
|
745 |
+
</tr>
|
746 |
+
<tr>
|
747 |
+
<td>Blue:</td>
|
748 |
+
<td>CDR</td>
|
749 |
+
</tr>
|
750 |
+
<tr>
|
751 |
+
<td>Green:</td>
|
752 |
+
<td>N-glycosylation site</td>
|
753 |
+
</tr>
|
754 |
+
</table>
|
755 |
+
<hr>
|
756 |
+
</div>
|
757 |
+
|
758 |
+
<div class="table-container">
|
759 |
+
<h2>Table 18</h2>
|
760 |
+
<table border="1">
|
761 |
+
<tr>
|
762 |
+
<td>Sequence</td>
|
763 |
+
<td>Sequence location</td>
|
764 |
+
<td>Modification</td>
|
765 |
+
<td>Relative abundance</td>
|
766 |
+
<td>Relative abundance</td>
|
767 |
+
</tr>
|
768 |
+
<tr>
|
769 |
+
<td>Sequence</td>
|
770 |
+
<td>Sequence location</td>
|
771 |
+
<td>Modification</td>
|
772 |
+
<td>L5-H12_T0</td>
|
773 |
+
<td>L5-H12_T4w</td>
|
774 |
+
</tr>
|
775 |
+
<tr>
|
776 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
777 |
+
<td>HC (001-038)</td>
|
778 |
+
<td>pyro Q</td>
|
779 |
+
<td>85.5%</td>
|
780 |
+
<td>99.3%</td>
|
781 |
+
</tr>
|
782 |
+
<tr>
|
783 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
784 |
+
<td>HC (001-038)</td>
|
785 |
+
<td></td>
|
786 |
+
<td>14.5%</td>
|
787 |
+
<td>0.7%</td>
|
788 |
+
</tr>
|
789 |
+
</table>
|
790 |
+
<hr>
|
791 |
+
</div>
|
792 |
+
|
793 |
+
<div class="table-container">
|
794 |
+
<h2>Table 19</h2>
|
795 |
+
<table border="1">
|
796 |
+
<tr>
|
797 |
+
<td>Sequence</td>
|
798 |
+
<td>Sequence location</td>
|
799 |
+
<td>Modification</td>
|
800 |
+
<td>Relative abundance*</td>
|
801 |
+
<td>Relative abundance*</td>
|
802 |
+
</tr>
|
803 |
+
<tr>
|
804 |
+
<td>Sequence</td>
|
805 |
+
<td>Sequence location</td>
|
806 |
+
<td>Modification</td>
|
807 |
+
<td>L5-H12_T0</td>
|
808 |
+
<td>L5-H12_T4w</td>
|
809 |
+
</tr>
|
810 |
+
<tr>
|
811 |
+
<td>STSGGTAALGCLVK</td>
|
812 |
+
<td>HC (134-147)</td>
|
813 |
+
<td></td>
|
814 |
+
<td>99.9%</td>
|
815 |
+
<td>98.7%</td>
|
816 |
+
</tr>
|
817 |
+
<tr>
|
818 |
+
<td>GTAALGCLVK</td>
|
819 |
+
<td>HC (134-147)</td>
|
820 |
+
<td>Clipping</td>
|
821 |
+
<td>0.1%</td>
|
822 |
+
<td>1.3%</td>
|
823 |
+
</tr>
|
824 |
+
<tr>
|
825 |
+
<td>SSSNPLTFGAGTK</td>
|
826 |
+
<td>LC (91-103)</td>
|
827 |
+
<td></td>
|
828 |
+
<td>99.8%</td>
|
829 |
+
<td>98.9%</td>
|
830 |
+
</tr>
|
831 |
+
<tr>
|
832 |
+
<td>PLTFGAGTK</td>
|
833 |
+
<td>LC (91-103)</td>
|
834 |
+
<td>Clipping</td>
|
835 |
+
<td>0.2%</td>
|
836 |
+
<td>1.1%</td>
|
837 |
+
</tr>
|
838 |
+
</table>
|
839 |
+
<hr>
|
840 |
+
</div>
|
841 |
+
|
842 |
+
<div class="table-container">
|
843 |
+
<h2>Table 20</h2>
|
844 |
+
<table border="1">
|
845 |
+
<tr>
|
846 |
+
<td>Blue:</td>
|
847 |
+
<td>VH and VL</td>
|
848 |
+
</tr>
|
849 |
+
<tr>
|
850 |
+
<td>Blue:</td>
|
851 |
+
<td>CDR</td>
|
852 |
+
</tr>
|
853 |
+
<tr>
|
854 |
+
<td>Green:</td>
|
855 |
+
<td>N-glycosylation site</td>
|
856 |
+
</tr>
|
857 |
+
</table>
|
858 |
+
<hr>
|
859 |
+
</div>
|
860 |
+
|
861 |
+
<div class="table-container">
|
862 |
+
<h2>Table 21</h2>
|
863 |
+
<table border="1">
|
864 |
+
<tr>
|
865 |
+
<td>Sequence</td>
|
866 |
+
<td>Sequence location</td>
|
867 |
+
<td>Modification</td>
|
868 |
+
<td>Relative abundance</td>
|
869 |
+
<td>Relative abundance</td>
|
870 |
+
</tr>
|
871 |
+
<tr>
|
872 |
+
<td>Sequence</td>
|
873 |
+
<td>Sequence location</td>
|
874 |
+
<td>Modification</td>
|
875 |
+
<td>L5-H31_T0</td>
|
876 |
+
<td>L5-H31_T4w</td>
|
877 |
+
</tr>
|
878 |
+
<tr>
|
879 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
880 |
+
<td>HC (001-038)</td>
|
881 |
+
<td>pyro Q</td>
|
882 |
+
<td>83.5%</td>
|
883 |
+
<td>99.5%</td>
|
884 |
+
</tr>
|
885 |
+
<tr>
|
886 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
887 |
+
<td>HC (001-038)</td>
|
888 |
+
<td></td>
|
889 |
+
<td>16.5%</td>
|
890 |
+
<td>0.5%</td>
|
891 |
+
</tr>
|
892 |
+
</table>
|
893 |
+
<hr>
|
894 |
+
</div>
|
895 |
+
|
896 |
+
<div class="table-container">
|
897 |
+
<h2>Table 22</h2>
|
898 |
+
<table border="1">
|
899 |
+
<tr>
|
900 |
+
<td>Sequence</td>
|
901 |
+
<td>Sequence location</td>
|
902 |
+
<td>Modification</td>
|
903 |
+
<td>Relative abundance</td>
|
904 |
+
<td>Relative abundance</td>
|
905 |
+
</tr>
|
906 |
+
<tr>
|
907 |
+
<td>Sequence</td>
|
908 |
+
<td>Sequence location</td>
|
909 |
+
<td>Modification</td>
|
910 |
+
<td>L5-H31_T0</td>
|
911 |
+
<td>L5-H31_T4w</td>
|
912 |
+
</tr>
|
913 |
+
<tr>
|
914 |
+
<td>NFGNYAMDFWGQGTSVTVSSASTK</td>
|
915 |
+
<td>HC(98-121)</td>
|
916 |
+
<td>Ox. [+ 16 Da]</td>
|
917 |
+
<td>4.9%</td>
|
918 |
+
<td>1.9%</td>
|
919 |
+
</tr>
|
920 |
+
<tr>
|
921 |
+
<td>NFGNYAMDFWGQGTSVTVSSASTK</td>
|
922 |
+
<td>HC(98-121)</td>
|
923 |
+
<td></td>
|
924 |
+
<td>95.1%</td>
|
925 |
+
<td>98.1%</td>
|
926 |
+
</tr>
|
927 |
+
</table>
|
928 |
+
<hr>
|
929 |
+
</div>
|
930 |
+
|
931 |
+
<div class="table-container">
|
932 |
+
<h2>Table 23</h2>
|
933 |
+
<table border="1">
|
934 |
+
<tr>
|
935 |
+
<td>Sequence</td>
|
936 |
+
<td>Sequence location</td>
|
937 |
+
<td>Modification</td>
|
938 |
+
<td>Relative abundance</td>
|
939 |
+
<td>Relative abundance</td>
|
940 |
+
</tr>
|
941 |
+
<tr>
|
942 |
+
<td>Sequence</td>
|
943 |
+
<td>Sequence location</td>
|
944 |
+
<td>Modification</td>
|
945 |
+
<td>L5-H31_T0</td>
|
946 |
+
<td>L5-H31_T4w</td>
|
947 |
+
</tr>
|
948 |
+
<tr>
|
949 |
+
<td>SSSNPLTFGAGTK</td>
|
950 |
+
<td>LC (91-103)</td>
|
951 |
+
<td></td>
|
952 |
+
<td>99.8%</td>
|
953 |
+
<td>99.5%</td>
|
954 |
+
</tr>
|
955 |
+
<tr>
|
956 |
+
<td>SSSNPLTFGAGTK</td>
|
957 |
+
<td>LC (91-103)</td>
|
958 |
+
<td>deamidation</td>
|
959 |
+
<td>0.2%</td>
|
960 |
+
<td>0.5%</td>
|
961 |
+
</tr>
|
962 |
+
</table>
|
963 |
+
<hr>
|
964 |
+
</div>
|
965 |
+
|
966 |
+
<div class="table-container">
|
967 |
+
<h2>Table 24</h2>
|
968 |
+
<table border="1">
|
969 |
+
<tr>
|
970 |
+
<td>Sequence</td>
|
971 |
+
<td>Sequence location</td>
|
972 |
+
<td>Modification</td>
|
973 |
+
<td>Relative abundance*</td>
|
974 |
+
<td>Relative abundance*</td>
|
975 |
+
</tr>
|
976 |
+
<tr>
|
977 |
+
<td>Sequence</td>
|
978 |
+
<td>Sequence location</td>
|
979 |
+
<td>Modification</td>
|
980 |
+
<td>L5-H31_T0</td>
|
981 |
+
<td>L5-H31_T4w</td>
|
982 |
+
</tr>
|
983 |
+
<tr>
|
984 |
+
<td>STSGGTAALGCLVK</td>
|
985 |
+
<td>HC (134-147)</td>
|
986 |
+
<td></td>
|
987 |
+
<td>99.9%</td>
|
988 |
+
<td>98.8%</td>
|
989 |
+
</tr>
|
990 |
+
<tr>
|
991 |
+
<td>GTAALGCLVK</td>
|
992 |
+
<td>HC (134-147)</td>
|
993 |
+
<td>Clipping</td>
|
994 |
+
<td>0.1%</td>
|
995 |
+
<td>1.2%</td>
|
996 |
+
</tr>
|
997 |
+
<tr>
|
998 |
+
<td>SSSNPLTFGAGTK</td>
|
999 |
+
<td>LC (91-103)</td>
|
1000 |
+
<td></td>
|
1001 |
+
<td>99.9%</td>
|
1002 |
+
<td>98.8%</td>
|
1003 |
+
</tr>
|
1004 |
+
<tr>
|
1005 |
+
<td>PLTFGAGTK</td>
|
1006 |
+
<td>LC (91-103)</td>
|
1007 |
+
<td>Clipping</td>
|
1008 |
+
<td>0.1%</td>
|
1009 |
+
<td>1.2%</td>
|
1010 |
+
</tr>
|
1011 |
+
</table>
|
1012 |
+
<hr>
|
1013 |
+
</div>
|
1014 |
+
|
1015 |
+
<div class="table-container">
|
1016 |
+
<h2>Table 25</h2>
|
1017 |
+
<table border="1">
|
1018 |
+
<tr>
|
1019 |
+
<td>Blue:</td>
|
1020 |
+
<td>VH and VL</td>
|
1021 |
+
</tr>
|
1022 |
+
<tr>
|
1023 |
+
<td>Blue:</td>
|
1024 |
+
<td>CDR</td>
|
1025 |
+
</tr>
|
1026 |
+
<tr>
|
1027 |
+
<td>Green:</td>
|
1028 |
+
<td>N-glycosylation site</td>
|
1029 |
+
</tr>
|
1030 |
+
</table>
|
1031 |
+
<hr>
|
1032 |
+
</div>
|
1033 |
+
|
1034 |
+
<div class="table-container">
|
1035 |
+
<h2>Table 26</h2>
|
1036 |
+
<table border="1">
|
1037 |
+
<tr>
|
1038 |
+
<td>Sequence</td>
|
1039 |
+
<td>Sequence location</td>
|
1040 |
+
<td>Modification</td>
|
1041 |
+
<td>Relative abundance</td>
|
1042 |
+
<td>Relative abundance</td>
|
1043 |
+
</tr>
|
1044 |
+
<tr>
|
1045 |
+
<td>Sequence</td>
|
1046 |
+
<td>Sequence location</td>
|
1047 |
+
<td>Modification</td>
|
1048 |
+
<td>L14-H12_T0</td>
|
1049 |
+
<td>L14-H12_T4w</td>
|
1050 |
+
</tr>
|
1051 |
+
<tr>
|
1052 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
1053 |
+
<td>HC(001-038)</td>
|
1054 |
+
<td>pyroQ</td>
|
1055 |
+
<td>85.9%</td>
|
1056 |
+
<td>99.3%</td>
|
1057 |
+
</tr>
|
1058 |
+
<tr>
|
1059 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
1060 |
+
<td>HC(001-038)</td>
|
1061 |
+
<td></td>
|
1062 |
+
<td>14.1%</td>
|
1063 |
+
<td>0.7%</td>
|
1064 |
+
</tr>
|
1065 |
+
</table>
|
1066 |
+
<hr>
|
1067 |
+
</div>
|
1068 |
+
|
1069 |
+
<div class="table-container">
|
1070 |
+
<h2>Table 27</h2>
|
1071 |
+
<table border="1">
|
1072 |
+
<tr>
|
1073 |
+
<td>Sequence</td>
|
1074 |
+
<td>Sequence location</td>
|
1075 |
+
<td>Modification</td>
|
1076 |
+
<td>Relative abundance</td>
|
1077 |
+
<td>Relative abundance</td>
|
1078 |
+
</tr>
|
1079 |
+
<tr>
|
1080 |
+
<td>Sequence</td>
|
1081 |
+
<td>Sequence location</td>
|
1082 |
+
<td>Modification</td>
|
1083 |
+
<td>L14-H12_T0</td>
|
1084 |
+
<td>L14-H12_T4w</td>
|
1085 |
+
</tr>
|
1086 |
+
<tr>
|
1087 |
+
<td>ASTSVTYMHWYQQKPGK</td>
|
1088 |
+
<td>LC(25-41)</td>
|
1089 |
+
<td>Ox. [+16 Da]</td>
|
1090 |
+
<td>0.3%</td>
|
1091 |
+
<td>0.3%</td>
|
1092 |
+
</tr>
|
1093 |
+
<tr>
|
1094 |
+
<td>ASTSVTYMHWYQQKPGK</td>
|
1095 |
+
<td>LC(25-41)</td>
|
1096 |
+
<td></td>
|
1097 |
+
<td>99.7%</td>
|
1098 |
+
<td>99.7%</td>
|
1099 |
+
</tr>
|
1100 |
+
</table>
|
1101 |
+
<hr>
|
1102 |
+
</div>
|
1103 |
+
|
1104 |
+
<div class="table-container">
|
1105 |
+
<h2>Table 28</h2>
|
1106 |
+
<table border="1">
|
1107 |
+
<tr>
|
1108 |
+
<td>Sequence</td>
|
1109 |
+
<td>Sequence location</td>
|
1110 |
+
<td>Modification</td>
|
1111 |
+
<td>Relative abundance</td>
|
1112 |
+
<td>Relative abundance</td>
|
1113 |
+
</tr>
|
1114 |
+
<tr>
|
1115 |
+
<td>Sequence</td>
|
1116 |
+
<td>Sequence location</td>
|
1117 |
+
<td>Modification</td>
|
1118 |
+
<td>L14-H12_T0</td>
|
1119 |
+
<td>L14-H12_T4w</td>
|
1120 |
+
</tr>
|
1121 |
+
<tr>
|
1122 |
+
<td>SSSNPLTFGAGTK</td>
|
1123 |
+
<td>LC (91-103)</td>
|
1124 |
+
<td></td>
|
1125 |
+
<td>99.9%</td>
|
1126 |
+
<td>99.4%</td>
|
1127 |
+
</tr>
|
1128 |
+
<tr>
|
1129 |
+
<td>SSSNPLTFGAGTK</td>
|
1130 |
+
<td>LC (91-103)</td>
|
1131 |
+
<td>deamidation</td>
|
1132 |
+
<td>0.1%</td>
|
1133 |
+
<td>0.6%</td>
|
1134 |
+
</tr>
|
1135 |
+
</table>
|
1136 |
+
<hr>
|
1137 |
+
</div>
|
1138 |
+
|
1139 |
+
<div class="table-container">
|
1140 |
+
<h2>Table 29</h2>
|
1141 |
+
<table border="1">
|
1142 |
+
<tr>
|
1143 |
+
<td>Sequence</td>
|
1144 |
+
<td>Sequence location</td>
|
1145 |
+
<td>Modification</td>
|
1146 |
+
<td>Relative abundance*</td>
|
1147 |
+
<td>Relative abundance*</td>
|
1148 |
+
</tr>
|
1149 |
+
<tr>
|
1150 |
+
<td>Sequence</td>
|
1151 |
+
<td>Sequence location</td>
|
1152 |
+
<td>Modification</td>
|
1153 |
+
<td>L14-H12_T0</td>
|
1154 |
+
<td>L14-H12_T4w</td>
|
1155 |
+
</tr>
|
1156 |
+
<tr>
|
1157 |
+
<td>STSGGTAALGCLVK</td>
|
1158 |
+
<td>HC (134-147)</td>
|
1159 |
+
<td></td>
|
1160 |
+
<td>99.9%</td>
|
1161 |
+
<td>98.9%</td>
|
1162 |
+
</tr>
|
1163 |
+
<tr>
|
1164 |
+
<td>GTAALGCLVK</td>
|
1165 |
+
<td>HC (134-147)</td>
|
1166 |
+
<td>Clipping</td>
|
1167 |
+
<td>0.1%</td>
|
1168 |
+
<td>1.1%</td>
|
1169 |
+
</tr>
|
1170 |
+
<tr>
|
1171 |
+
<td>SSSNPLTFGAGTK</td>
|
1172 |
+
<td>LC (91-103)</td>
|
1173 |
+
<td></td>
|
1174 |
+
<td>99.7%</td>
|
1175 |
+
<td>98.6%</td>
|
1176 |
+
</tr>
|
1177 |
+
<tr>
|
1178 |
+
<td>PLTFGAGTK</td>
|
1179 |
+
<td>LC (91-103)</td>
|
1180 |
+
<td>Clipping</td>
|
1181 |
+
<td>0.3%</td>
|
1182 |
+
<td>1.4%</td>
|
1183 |
+
</tr>
|
1184 |
+
</table>
|
1185 |
+
<hr>
|
1186 |
+
</div>
|
1187 |
+
|
1188 |
+
<div class="table-container">
|
1189 |
+
<h2>Table 30</h2>
|
1190 |
+
<table border="1">
|
1191 |
+
<tr>
|
1192 |
+
<td>Blue:</td>
|
1193 |
+
<td>VH and VL</td>
|
1194 |
+
</tr>
|
1195 |
+
<tr>
|
1196 |
+
<td>Blue:</td>
|
1197 |
+
<td>CDR</td>
|
1198 |
+
</tr>
|
1199 |
+
<tr>
|
1200 |
+
<td>Green:</td>
|
1201 |
+
<td>N-glycosylation site</td>
|
1202 |
+
</tr>
|
1203 |
+
</table>
|
1204 |
+
<hr>
|
1205 |
+
</div>
|
1206 |
+
|
1207 |
+
<div class="table-container">
|
1208 |
+
<h2>Table 31</h2>
|
1209 |
+
<table border="1">
|
1210 |
+
<tr>
|
1211 |
+
<td>Sequence</td>
|
1212 |
+
<td>Sequence location</td>
|
1213 |
+
<td>Modification</td>
|
1214 |
+
<td>Relative abundance</td>
|
1215 |
+
<td>Relative abundance</td>
|
1216 |
+
</tr>
|
1217 |
+
<tr>
|
1218 |
+
<td>Sequence</td>
|
1219 |
+
<td>Sequence location</td>
|
1220 |
+
<td>Modification</td>
|
1221 |
+
<td>L14-H31_T0</td>
|
1222 |
+
<td>L14-H31_T4w</td>
|
1223 |
+
</tr>
|
1224 |
+
<tr>
|
1225 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
1226 |
+
<td>HC(001-038)</td>
|
1227 |
+
<td>pyroQ</td>
|
1228 |
+
<td>82.6%</td>
|
1229 |
+
<td>100.0%</td>
|
1230 |
+
</tr>
|
1231 |
+
<tr>
|
1232 |
+
<td>QVQLQESGPGLVKPSQTLSLTCTVSGFSLTNYGVYWIR</td>
|
1233 |
+
<td>HC(001-038)</td>
|
1234 |
+
<td></td>
|
1235 |
+
<td>17.4%</td>
|
1236 |
+
<td>n.d</td>
|
1237 |
+
</tr>
|
1238 |
+
</table>
|
1239 |
+
<hr>
|
1240 |
+
</div>
|
1241 |
+
|
1242 |
+
<div class="table-container">
|
1243 |
+
<h2>Table 32</h2>
|
1244 |
+
<table border="1">
|
1245 |
+
<tr>
|
1246 |
+
<td>Sequence</td>
|
1247 |
+
<td>Sequence location</td>
|
1248 |
+
<td>Modification</td>
|
1249 |
+
<td>Relative abundance</td>
|
1250 |
+
<td>Relative abundance</td>
|
1251 |
+
</tr>
|
1252 |
+
<tr>
|
1253 |
+
<td>Sequence</td>
|
1254 |
+
<td>Sequence location</td>
|
1255 |
+
<td>Modification</td>
|
1256 |
+
<td>L14-H31_T0</td>
|
1257 |
+
<td>L14-H31_T4w</td>
|
1258 |
+
</tr>
|
1259 |
+
<tr>
|
1260 |
+
<td>ASTSVTYMHWYQQKPGK</td>
|
1261 |
+
<td>LC(25-41)</td>
|
1262 |
+
<td>Ox. [+16 Da]</td>
|
1263 |
+
<td>0.5%</td>
|
1264 |
+
<td>0.4%</td>
|
1265 |
+
</tr>
|
1266 |
+
<tr>
|
1267 |
+
<td>ASTSVTYMHWYQQKPGK</td>
|
1268 |
+
<td>LC(25-41)</td>
|
1269 |
+
<td></td>
|
1270 |
+
<td>99.5%</td>
|
1271 |
+
<td>99.6%</td>
|
1272 |
+
</tr>
|
1273 |
+
</table>
|
1274 |
+
<hr>
|
1275 |
+
</div>
|
1276 |
+
|
1277 |
+
<div class="table-container">
|
1278 |
+
<h2>Table 33</h2>
|
1279 |
+
<table border="1">
|
1280 |
+
<tr>
|
1281 |
+
<td>Sequence</td>
|
1282 |
+
<td>Sequence location</td>
|
1283 |
+
<td>Modification</td>
|
1284 |
+
<td>Relative abundance</td>
|
1285 |
+
<td>Relative abundance</td>
|
1286 |
+
</tr>
|
1287 |
+
<tr>
|
1288 |
+
<td>Sequence</td>
|
1289 |
+
<td>Sequence location</td>
|
1290 |
+
<td>Modification</td>
|
1291 |
+
<td>L14-H31_T0</td>
|
1292 |
+
<td>L14-H31_T4w</td>
|
1293 |
+
</tr>
|
1294 |
+
<tr>
|
1295 |
+
<td>SSSNPLTFGAGTK</td>
|
1296 |
+
<td>LC (91-103)</td>
|
1297 |
+
<td></td>
|
1298 |
+
<td>99.9%</td>
|
1299 |
+
<td>99.5%</td>
|
1300 |
+
</tr>
|
1301 |
+
<tr>
|
1302 |
+
<td>SSSNPLTFGAGTK</td>
|
1303 |
+
<td>LC (91-103)</td>
|
1304 |
+
<td>deamidation</td>
|
1305 |
+
<td>0.1%</td>
|
1306 |
+
<td>0.5%</td>
|
1307 |
+
</tr>
|
1308 |
+
</table>
|
1309 |
+
<hr>
|
1310 |
+
</div>
|
1311 |
+
|
1312 |
+
<div class="table-container">
|
1313 |
+
<h2>Table 34</h2>
|
1314 |
+
<table border="1">
|
1315 |
+
<tr>
|
1316 |
+
<td>Sequence</td>
|
1317 |
+
<td>Sequence location</td>
|
1318 |
+
<td>Modification</td>
|
1319 |
+
<td>Relative abundance*</td>
|
1320 |
+
<td>Relative abundance*</td>
|
1321 |
+
</tr>
|
1322 |
+
<tr>
|
1323 |
+
<td>Sequence</td>
|
1324 |
+
<td>Sequence location</td>
|
1325 |
+
<td>Modification</td>
|
1326 |
+
<td>L14-H31_T0</td>
|
1327 |
+
<td>L14-H31_T4w</td>
|
1328 |
+
</tr>
|
1329 |
+
<tr>
|
1330 |
+
<td>STSGGTAALGCLVK</td>
|
1331 |
+
<td>HC (134-147)</td>
|
1332 |
+
<td></td>
|
1333 |
+
<td>99.9%</td>
|
1334 |
+
<td>98.9%</td>
|
1335 |
+
</tr>
|
1336 |
+
<tr>
|
1337 |
+
<td>GTAALGCLVK</td>
|
1338 |
+
<td>HC (134-147)</td>
|
1339 |
+
<td>Clipping</td>
|
1340 |
+
<td>0.1%</td>
|
1341 |
+
<td>1.1%</td>
|
1342 |
+
</tr>
|
1343 |
+
<tr>
|
1344 |
+
<td>SSSNPLTFGAGTK</td>
|
1345 |
+
<td>LC (91-103)</td>
|
1346 |
+
<td></td>
|
1347 |
+
<td>99.7%</td>
|
1348 |
+
<td>98.4%</td>
|
1349 |
+
</tr>
|
1350 |
+
<tr>
|
1351 |
+
<td>PLTFGAGTK</td>
|
1352 |
+
<td>LC (91-103)</td>
|
1353 |
+
<td>Clipping</td>
|
1354 |
+
<td>0.3%</td>
|
1355 |
+
<td>1.6%</td>
|
1356 |
+
</tr>
|
1357 |
+
</table>
|
1358 |
+
<hr>
|
1359 |
+
</div>
|
1360 |
+
|
1361 |
+
<div class="table-container">
|
1362 |
+
<h2>Table 35</h2>
|
1363 |
+
<table border="1">
|
1364 |
+
<tr>
|
1365 |
+
<td>Blue:</td>
|
1366 |
+
<td>VH and VL</td>
|
1367 |
+
</tr>
|
1368 |
+
<tr>
|
1369 |
+
<td>Blue:</td>
|
1370 |
+
<td>CDR</td>
|
1371 |
+
</tr>
|
1372 |
+
<tr>
|
1373 |
+
<td>Green:</td>
|
1374 |
+
<td>N-glycosylation site</td>
|
1375 |
+
</tr>
|
1376 |
+
</table>
|
1377 |
+
<hr>
|
1378 |
+
</div>
|
1379 |
+
|
1380 |
+
<div class="table-container">
|
1381 |
+
<h2>Table 36</h2>
|
1382 |
+
<table border="1">
|
1383 |
+
<tr>
|
1384 |
+
<td>Nathan Cardon</td>
|
1385 |
+
<td>Date:</td>
|
1386 |
+
</tr>
|
1387 |
+
<tr>
|
1388 |
+
<td>Sr Research Associate</td>
|
1389 |
+
<td>Signature:</td>
|
1390 |
+
</tr>
|
1391 |
+
<tr>
|
1392 |
+
<td>Mabelle Meersseman</td>
|
1393 |
+
<td>Date:</td>
|
1394 |
+
</tr>
|
1395 |
+
<tr>
|
1396 |
+
<td>Group Leader</td>
|
1397 |
+
<td>Signature:</td>
|
1398 |
+
</tr>
|
1399 |
+
<tr>
|
1400 |
+
<td>Approver</td>
|
1401 |
+
<td></td>
|
1402 |
+
</tr>
|
1403 |
+
<tr>
|
1404 |
+
<td>Koen Sandra Ph.D.</td>
|
1405 |
+
<td>Date:</td>
|
1406 |
+
</tr>
|
1407 |
+
<tr>
|
1408 |
+
<td>CEO</td>
|
1409 |
+
<td>Signature:</td>
|
1410 |
+
</tr>
|
1411 |
+
</table>
|
1412 |
+
<hr>
|
1413 |
+
</div>
|
1414 |
+
|
1415 |
+
<div class="table-container">
|
1416 |
+
<h2>Table 37</h2>
|
1417 |
+
<table border="1">
|
1418 |
+
<tr>
|
1419 |
+
<td>Version</td>
|
1420 |
+
<td>Date of issue</td>
|
1421 |
+
<td>Reason for version update</td>
|
1422 |
+
</tr>
|
1423 |
+
<tr>
|
1424 |
+
<td>00</td>
|
1425 |
+
<td>25NOV24</td>
|
1426 |
+
<td>Draft</td>
|
1427 |
+
</tr>
|
1428 |
+
<tr>
|
1429 |
+
<td></td>
|
1430 |
+
<td></td>
|
1431 |
+
<td></td>
|
1432 |
+
</tr>
|
1433 |
+
<tr>
|
1434 |
+
<td></td>
|
1435 |
+
<td></td>
|
1436 |
+
<td></td>
|
1437 |
+
</tr>
|
1438 |
+
</table>
|
1439 |
+
<hr>
|
1440 |
+
</div>
|
1441 |
+
</body></html>
|
src/agents/__pycache__/field_mapper_agent.cpython-312.pyc
CHANGED
Binary files a/src/agents/__pycache__/field_mapper_agent.cpython-312.pyc and b/src/agents/__pycache__/field_mapper_agent.cpython-312.pyc differ
|
|
src/app.py
CHANGED
@@ -7,6 +7,7 @@ from dotenv import load_dotenv
|
|
7 |
from orchestrator.planner import Planner
|
8 |
from orchestrator.executor import Executor
|
9 |
from config.settings import settings
|
|
|
10 |
import fitz # PyMuPDF local import to avoid heavy load on startup
|
11 |
import pandas as pd
|
12 |
from datetime import datetime
|
@@ -35,6 +36,18 @@ class LogCaptureHandler(logging.StreamHandler):
|
|
35 |
if 'execution_history' not in st.session_state:
|
36 |
st.session_state.execution_history = []
|
37 |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
38 |
# Set up logging capture
|
39 |
log_capture = LogCaptureHandler()
|
40 |
log_capture.setFormatter(logging.Formatter('%(asctime)s - %(name)s - %(levelname)s - %(message)s'))
|
@@ -231,160 +244,242 @@ elif page == "Traces":
|
|
231 |
else: # page == "Execution"
|
232 |
st.title("Deep‑Research PDF Field Extractor (POC)")
|
233 |
|
234 |
-
|
235 |
-
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
236 |
|
237 |
-
|
238 |
-
|
239 |
-
st.markdown("""
|
240 |
-
Add field descriptions to help the system better understand what to extract.
|
241 |
-
You can add multiple rows to describe different aspects of each field.
|
242 |
-
""")
|
243 |
|
244 |
-
#
|
245 |
-
|
246 |
-
|
247 |
-
|
248 |
-
|
249 |
-
|
250 |
-
|
251 |
-
|
252 |
-
|
253 |
-
|
254 |
-
|
255 |
-
|
256 |
-
|
257 |
-
|
258 |
-
|
259 |
-
|
260 |
-
|
261 |
-
|
262 |
-
|
263 |
-
|
264 |
-
|
265 |
-
|
266 |
-
|
267 |
-
|
268 |
-
|
269 |
-
|
270 |
-
|
271 |
-
|
272 |
-
|
273 |
-
|
274 |
-
|
275 |
-
|
276 |
-
|
277 |
-
|
278 |
-
|
279 |
-
|
280 |
-
|
281 |
-
|
282 |
-
|
283 |
-
|
284 |
-
|
285 |
-
|
286 |
-
|
287 |
-
|
288 |
-
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
289 |
col1, col2, col3, col4, col5, col6 = st.columns([2, 3, 2, 2, 2, 1])
|
290 |
|
291 |
with col1:
|
292 |
-
|
293 |
with col2:
|
294 |
-
|
295 |
with col3:
|
296 |
-
|
297 |
with col4:
|
298 |
-
|
299 |
with col5:
|
300 |
-
|
301 |
with col6:
|
302 |
-
|
303 |
-
st.session_state.field_descriptions_table.pop(i)
|
304 |
-
st.rerun()
|
305 |
|
306 |
-
#
|
307 |
-
st.session_state.field_descriptions_table
|
308 |
-
|
309 |
-
|
310 |
-
|
311 |
-
|
312 |
-
|
313 |
-
|
314 |
-
|
315 |
-
|
316 |
-
|
317 |
-
|
318 |
-
|
319 |
-
|
320 |
-
|
321 |
-
|
322 |
-
|
323 |
-
|
324 |
-
|
325 |
-
|
326 |
-
|
327 |
-
|
328 |
-
|
329 |
-
|
330 |
-
|
331 |
-
|
332 |
-
|
333 |
-
'format': row['format'],
|
334 |
-
'examples': row['examples'],
|
335 |
-
'possible_values': row['possible_values']
|
336 |
-
}
|
337 |
-
|
338 |
-
# Add strategy selector
|
339 |
-
strategy = st.radio(
|
340 |
-
"Select Extraction Strategy",
|
341 |
-
["Original Strategy", "Unique Indices Strategy"],
|
342 |
-
help="Original Strategy: Process document page by page. Unique Indices Strategy: Process entire document at once using unique indices."
|
343 |
-
)
|
344 |
-
|
345 |
-
# Add unique indices input if Unique Indices Strategy is selected
|
346 |
-
unique_indices = None
|
347 |
-
unique_indices_descriptions = None
|
348 |
-
if strategy == "Unique Indices Strategy":
|
349 |
-
# Add descriptions for each unique index using the same table format
|
350 |
-
st.subheader("Unique Fields Descriptions")
|
351 |
-
st.markdown("""
|
352 |
-
Please provide a description for each unique field. This helps the system better understand what to look for.
|
353 |
-
""")
|
354 |
|
355 |
-
#
|
356 |
-
if
|
357 |
-
|
358 |
-
|
359 |
-
|
360 |
-
|
361 |
-
|
362 |
-
|
363 |
-
|
364 |
-
|
365 |
-
|
366 |
-
|
367 |
-
|
368 |
-
|
369 |
-
|
370 |
-
|
371 |
-
|
372 |
-
|
373 |
-
|
374 |
-
|
375 |
-
|
376 |
-
'format': 'String',
|
377 |
-
'examples': '0w',
|
378 |
-
'possible_values': '0w, 2w, 4w, 6w'
|
379 |
-
},
|
380 |
-
{
|
381 |
-
'field_name': 'Modification',
|
382 |
-
'field_description': 'Any chemical or structural alteration to the protein or peptide, such as deamidation, oxidation, clipping, or glycation, which may affect function or stability.',
|
383 |
-
'format': 'String',
|
384 |
-
'examples': 'deamidation',
|
385 |
-
'possible_values': 'Deamidation, Oxidation, Truncation, pyroE, Isomerization, N-glycosylation, NonConforming, pyroQ, Thioether, Clipping, O-glycosylation, Double deamidation'
|
386 |
-
}
|
387 |
-
]
|
388 |
|
389 |
# Create the table interface for unique indices
|
390 |
col1, col2, col3, col4, col5, col6 = st.columns([2, 3, 2, 2, 2, 1])
|
@@ -417,7 +512,7 @@ else: # page == "Execution"
|
|
417 |
with col5:
|
418 |
idx_field_possible_values = st.text_input("", value=row.get('possible_values', ''), key=f"unique_field_possible_values_{i}")
|
419 |
with col6:
|
420 |
-
if st.button("
|
421 |
st.session_state.unique_indices_descriptions_table.pop(i)
|
422 |
st.rerun()
|
423 |
|
@@ -431,7 +526,7 @@ else: # page == "Execution"
|
|
431 |
}
|
432 |
|
433 |
# Add new row button for unique indices
|
434 |
-
if st.button("Add Unique Field Description Row"):
|
435 |
st.session_state.unique_indices_descriptions_table.append({
|
436 |
'field_name': '',
|
437 |
'field_description': '',
|
@@ -441,6 +536,104 @@ else: # page == "Execution"
|
|
441 |
})
|
442 |
st.rerun()
|
443 |
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
444 |
# Convert unique indices table to JSON for processing and extract field names
|
445 |
unique_indices_descriptions = {}
|
446 |
unique_indices = []
|
@@ -454,210 +647,162 @@ else: # page == "Execution"
|
|
454 |
'examples': row['examples'],
|
455 |
'possible_values': row['possible_values']
|
456 |
}
|
457 |
-
|
458 |
-
|
459 |
-
|
460 |
-
|
461 |
-
|
462 |
-
|
463 |
-
|
464 |
-
# Handle the case where the response is a string
|
465 |
-
if isinstance(json_data, str):
|
466 |
-
logger.info("Input is a string, attempting to parse as JSON")
|
467 |
-
try:
|
468 |
-
json_data = json.loads(json_data)
|
469 |
-
logger.info("Successfully parsed JSON string")
|
470 |
-
except json.JSONDecodeError as e:
|
471 |
-
logger.error(f"Failed to parse JSON string: {e}")
|
472 |
-
return pd.DataFrame(columns=fields)
|
473 |
-
|
474 |
-
# If the data is wrapped in an array, get the first item
|
475 |
-
if isinstance(json_data, list) and len(json_data) > 0:
|
476 |
-
logger.info("Data is wrapped in an array, extracting first item")
|
477 |
-
json_data = json_data[0]
|
478 |
-
|
479 |
-
# If the data is a dictionary with numeric keys, get the first value
|
480 |
-
if isinstance(json_data, dict):
|
481 |
-
keys = list(json_data.keys())
|
482 |
-
logger.info(f"Checking dictionary keys: {keys}")
|
483 |
-
# Check if all keys are integers or string representations of integers
|
484 |
-
if all(isinstance(k, int) or (isinstance(k, str) and k.isdigit()) for k in keys):
|
485 |
-
logger.info("Data has numeric keys, extracting first value")
|
486 |
-
first_key = sorted(keys, key=lambda x: int(x) if isinstance(x, str) else x)[0]
|
487 |
-
json_data = json_data[first_key]
|
488 |
-
logger.info(f"Extracted data from key '{first_key}'")
|
489 |
-
|
490 |
-
logger.info(f"JSON data keys: {list(json_data.keys()) if isinstance(json_data, dict) else 'Not a dict'}")
|
491 |
-
|
492 |
-
# Create a list to store rows
|
493 |
-
rows = []
|
494 |
-
|
495 |
-
# Get the length of the first array to determine number of rows
|
496 |
-
if isinstance(json_data, dict) and len(json_data) > 0:
|
497 |
-
first_field = list(json_data.keys())[0]
|
498 |
-
num_rows = len(json_data[first_field]) if isinstance(json_data[first_field], list) else 1
|
499 |
-
logger.info(f"Number of rows to process: {num_rows}")
|
500 |
-
|
501 |
-
# Create a row for each index
|
502 |
-
for i in range(num_rows):
|
503 |
-
logger.debug(f"Processing row {i}")
|
504 |
-
row = {}
|
505 |
-
for field in fields:
|
506 |
-
if field in json_data and isinstance(json_data[field], list) and i < len(json_data[field]):
|
507 |
-
row[field] = json_data[field][i]
|
508 |
-
logger.debug(f"Field '{field}' value at index {i}: {json_data[field][i]}")
|
509 |
-
else:
|
510 |
-
row[field] = None
|
511 |
-
logger.debug(f"Field '{field}' not found or index {i} out of bounds")
|
512 |
-
rows.append(row)
|
513 |
else:
|
514 |
-
|
515 |
-
|
516 |
-
|
517 |
-
|
518 |
-
|
519 |
-
|
520 |
-
|
521 |
-
|
522 |
-
|
523 |
-
|
524 |
-
|
525 |
-
|
526 |
-
|
527 |
-
|
528 |
-
|
529 |
-
|
530 |
-
|
531 |
-
|
532 |
-
|
533 |
-
with st.spinner("Planning …"):
|
534 |
-
# quick first-page text preview to give LLM document context
|
535 |
-
doc = fitz.open(stream=pdf_file.getvalue(), filetype="pdf") # type: ignore[arg-type]
|
536 |
-
preview = "\n".join(page.get_text() for page in doc[:10])[:20000] # first 2 pages, 2k chars
|
537 |
-
|
538 |
-
# Create a cost tracker for this run
|
539 |
-
cost_tracker = CostTracker()
|
540 |
|
541 |
-
|
542 |
-
|
543 |
-
|
544 |
-
|
545 |
-
|
546 |
-
field_descs=field_descs,
|
547 |
-
strategy=strategy,
|
548 |
-
unique_indices=unique_indices,
|
549 |
-
unique_indices_descriptions=unique_indices_descriptions
|
550 |
-
)
|
551 |
-
|
552 |
-
# Add a visual separator
|
553 |
-
st.markdown("---")
|
554 |
|
555 |
-
|
556 |
-
|
557 |
-
results, logs = executor.run(plan, pdf_file)
|
558 |
|
559 |
-
|
560 |
-
|
561 |
-
|
562 |
-
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
563 |
|
564 |
-
|
565 |
-
|
566 |
-
|
567 |
-
logger.info(f" LLM output tokens: {executor.cost_tracker.llm_output_tokens}")
|
568 |
-
logger.info(f" DI pages: {executor.cost_tracker.di_pages}")
|
569 |
-
logger.info(f" LLM calls count: {len(executor.cost_tracker.llm_calls)}")
|
570 |
-
logger.info(f" Current file costs: {executor.cost_tracker.current_file_costs}")
|
571 |
-
logger.info(f" Calculated costs: {costs}")
|
572 |
|
573 |
-
|
574 |
-
|
575 |
-
|
576 |
-
|
577 |
|
578 |
-
|
579 |
-
f"
|
580 |
-
f"LLM
|
581 |
-
f"
|
582 |
-
f"
|
583 |
-
f"
|
584 |
-
f"
|
585 |
-
|
586 |
|
587 |
-
|
588 |
-
|
589 |
-
|
590 |
-
|
591 |
-
# Check if results is already a DataFrame
|
592 |
-
if isinstance(results, pd.DataFrame):
|
593 |
-
logger.info(f"Results is already a DataFrame with shape: {results.shape}")
|
594 |
-
logger.info(f"DataFrame columns: {results.columns.tolist()}")
|
595 |
-
logger.info(f"DataFrame head: {results.head()}")
|
596 |
-
df = results
|
597 |
-
else:
|
598 |
-
logger.info("Results is not a DataFrame, calling flatten_json_response")
|
599 |
-
# Process results using flatten_json_response
|
600 |
-
df = flatten_json_response(results, field_list)
|
601 |
-
|
602 |
-
# Log final DataFrame info
|
603 |
-
logger.info(f"Final DataFrame shape: {df.shape}")
|
604 |
-
logger.info(f"Final DataFrame columns: {df.columns.tolist()}")
|
605 |
-
if not df.empty:
|
606 |
-
logger.info(f"Final DataFrame sample: {df.head()}")
|
607 |
|
608 |
-
|
609 |
-
|
610 |
-
|
611 |
-
|
612 |
-
|
613 |
-
|
614 |
-
|
615 |
-
|
616 |
-
st.session_state.execution_history.append(execution_record)
|
617 |
-
log_capture.clear() # Clear logs after storing them
|
618 |
|
619 |
-
|
620 |
-
|
621 |
-
|
622 |
-
indent = " " * 4 * log["depth"]
|
623 |
-
# Add error indicator if there was an error
|
624 |
-
error_indicator = "❌ " if log.get("error") else "✓ "
|
625 |
-
# Use a fixed preview text instead of the result
|
626 |
-
with st.expander(f"{indent}{error_indicator}{log['tool']} – Click to view result"):
|
627 |
-
st.markdown(f"**Args**: `{log['args']}`", unsafe_allow_html=True)
|
628 |
-
if log.get("error"):
|
629 |
-
st.error(f"Error: {log['error']}")
|
630 |
|
631 |
-
#
|
632 |
-
if
|
633 |
-
|
634 |
-
|
635 |
-
|
636 |
-
|
637 |
-
stats_df = pd.DataFrame(log["result"]["chunk_stats"])
|
638 |
-
st.dataframe(stats_df)
|
639 |
-
|
640 |
-
# Add summary statistics
|
641 |
-
st.markdown("### Summary")
|
642 |
-
st.markdown(f"""
|
643 |
-
- Total chunks: {len(stats_df)}
|
644 |
-
- Average chunk length: {stats_df['length'].mean():.0f} characters
|
645 |
-
- Shortest chunk: {stats_df['length'].min()} characters
|
646 |
-
- Longest chunk: {stats_df['length'].max()} characters
|
647 |
-
""")
|
648 |
-
|
649 |
-
# Add a bar chart of chunk lengths
|
650 |
-
st.markdown("### Chunk Length Distribution")
|
651 |
-
st.bar_chart(stats_df.set_index('chunk_number')['length'])
|
652 |
else:
|
653 |
-
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
654 |
|
655 |
-
|
656 |
-
|
657 |
-
|
658 |
-
|
659 |
-
|
660 |
-
|
661 |
-
|
662 |
-
|
663 |
-
|
|
|
7 |
from orchestrator.planner import Planner
|
8 |
from orchestrator.executor import Executor
|
9 |
from config.settings import settings
|
10 |
+
from config.config_manager import config_manager
|
11 |
import fitz # PyMuPDF local import to avoid heavy load on startup
|
12 |
import pandas as pd
|
13 |
from datetime import datetime
|
|
|
36 |
if 'execution_history' not in st.session_state:
|
37 |
st.session_state.execution_history = []
|
38 |
|
39 |
+
# Initialize session state for field descriptions tables
|
40 |
+
if 'field_descriptions_table' not in st.session_state:
|
41 |
+
st.session_state.field_descriptions_table = []
|
42 |
+
|
43 |
+
# Initialize session state for unique indices descriptions table
|
44 |
+
if 'unique_indices_descriptions_table' not in st.session_state:
|
45 |
+
st.session_state.unique_indices_descriptions_table = []
|
46 |
+
|
47 |
+
# Initialize session state for fields string
|
48 |
+
if 'fields_str' not in st.session_state:
|
49 |
+
st.session_state.fields_str = "Chain, Percentage, Seq Loc"
|
50 |
+
|
51 |
# Set up logging capture
|
52 |
log_capture = LogCaptureHandler()
|
53 |
log_capture.setFormatter(logging.Formatter('%(asctime)s - %(name)s - %(levelname)s - %(message)s'))
|
|
|
244 |
else: # page == "Execution"
|
245 |
st.title("Deep‑Research PDF Field Extractor (POC)")
|
246 |
|
247 |
+
def flatten_json_response(json_data, fields):
|
248 |
+
"""Flatten the nested JSON response into a tabular structure with dynamic columns."""
|
249 |
+
logger = logging.getLogger(__name__)
|
250 |
+
logger.info("Starting flatten_json_response")
|
251 |
+
logger.info(f"Input fields: {fields}")
|
252 |
+
|
253 |
+
# Handle the case where the response is a string
|
254 |
+
if isinstance(json_data, str):
|
255 |
+
logger.info("Input is a string, attempting to parse as JSON")
|
256 |
+
try:
|
257 |
+
json_data = json.loads(json_data)
|
258 |
+
logger.info("Successfully parsed JSON string")
|
259 |
+
except json.JSONDecodeError as e:
|
260 |
+
logger.error(f"Failed to parse JSON string: {e}")
|
261 |
+
return pd.DataFrame(columns=fields)
|
262 |
+
|
263 |
+
# If the data is wrapped in an array, get the first item
|
264 |
+
if isinstance(json_data, list) and len(json_data) > 0:
|
265 |
+
logger.info("Data is wrapped in an array, extracting first item")
|
266 |
+
json_data = json_data[0]
|
267 |
+
|
268 |
+
# If the data is a dictionary with numeric keys, get the first value
|
269 |
+
if isinstance(json_data, dict):
|
270 |
+
keys = list(json_data.keys())
|
271 |
+
logger.info(f"Checking dictionary keys: {keys}")
|
272 |
+
# Check if all keys are integers or string representations of integers
|
273 |
+
if all(isinstance(k, int) or (isinstance(k, str) and k.isdigit()) for k in keys):
|
274 |
+
logger.info("Data has numeric keys, extracting first value")
|
275 |
+
first_key = sorted(keys, key=lambda x: int(x) if isinstance(x, str) else x)[0]
|
276 |
+
json_data = json_data[first_key]
|
277 |
+
logger.info(f"Extracted data from key '{first_key}'")
|
278 |
+
|
279 |
+
logger.info(f"JSON data keys: {list(json_data.keys()) if isinstance(json_data, dict) else 'Not a dict'}")
|
280 |
+
|
281 |
+
# Create a list to store rows
|
282 |
+
rows = []
|
283 |
+
|
284 |
+
# Get the length of the first array to determine number of rows
|
285 |
+
if isinstance(json_data, dict) and len(json_data) > 0:
|
286 |
+
first_field = list(json_data.keys())[0]
|
287 |
+
num_rows = len(json_data[first_field]) if isinstance(json_data[first_field], list) else 1
|
288 |
+
logger.info(f"Number of rows to process: {num_rows}")
|
289 |
+
|
290 |
+
# Create a row for each index
|
291 |
+
for i in range(num_rows):
|
292 |
+
logger.debug(f"Processing row {i}")
|
293 |
+
row = {}
|
294 |
+
for field in fields:
|
295 |
+
if field in json_data and isinstance(json_data[field], list) and i < len(json_data[field]):
|
296 |
+
row[field] = json_data[field][i]
|
297 |
+
logger.debug(f"Field '{field}' value at index {i}: {json_data[field][i]}")
|
298 |
+
else:
|
299 |
+
row[field] = None
|
300 |
+
logger.debug(f"Field '{field}' not found or index {i} out of bounds")
|
301 |
+
rows.append(row)
|
302 |
+
else:
|
303 |
+
logger.error(f"Unexpected data structure: {type(json_data)}")
|
304 |
+
return pd.DataFrame(columns=fields)
|
305 |
+
|
306 |
+
# Create DataFrame with all requested fields as columns
|
307 |
+
df = pd.DataFrame(rows)
|
308 |
+
logger.info(f"Created DataFrame with shape: {df.shape}")
|
309 |
+
logger.info(f"DataFrame columns: {df.columns.tolist()}")
|
310 |
+
|
311 |
+
# Ensure columns are in the same order as the fields list
|
312 |
+
df = df[fields]
|
313 |
+
logger.info(f"Final DataFrame columns after reordering: {df.columns.tolist()}")
|
314 |
+
|
315 |
+
return df
|
316 |
+
|
317 |
+
# ============================================================================
|
318 |
+
# SECTION 1: FILE UPLOAD
|
319 |
+
# ============================================================================
|
320 |
+
st.header("📄 Step 1: Upload Document")
|
321 |
+
pdf_file = st.file_uploader("Upload PDF", type=["pdf"], help="Select a PDF file to process")
|
322 |
|
323 |
+
if pdf_file:
|
324 |
+
st.success(f"✅ File uploaded: {pdf_file.name}")
|
|
|
|
|
|
|
|
|
325 |
|
326 |
+
# ============================================================================
|
327 |
+
# SECTION 2: STRATEGY SELECTION
|
328 |
+
# ============================================================================
|
329 |
+
st.header("🎯 Step 2: Select Extraction Strategy")
|
330 |
+
|
331 |
+
strategy = st.radio(
|
332 |
+
"Choose your extraction approach:",
|
333 |
+
["Original Strategy", "Unique Indices Strategy"],
|
334 |
+
help="**Original Strategy**: Process document page by page, extracting each field individually. **Unique Indices Strategy**: Process entire document at once using unique combinations of indices.",
|
335 |
+
horizontal=True
|
336 |
+
)
|
337 |
+
|
338 |
+
if strategy == "Original Strategy":
|
339 |
+
st.info("📋 **Original Strategy**: Will extract fields one by one from the document pages.")
|
340 |
+
else:
|
341 |
+
st.info("🔍 **Unique Indices Strategy**: Will find unique combinations and extract additional fields for each.")
|
342 |
+
|
343 |
+
# ============================================================================
|
344 |
+
# SECTION 3: CONFIGURATION (Only for Unique Indices Strategy)
|
345 |
+
# ============================================================================
|
346 |
+
if strategy == "Unique Indices Strategy":
|
347 |
+
st.header("⚙️ Step 3: Configuration")
|
348 |
+
|
349 |
+
# File Type Selection
|
350 |
+
col1, col2 = st.columns([3, 1])
|
351 |
+
with col1:
|
352 |
+
# Get available configurations
|
353 |
+
config_names = config_manager.get_config_names()
|
354 |
+
|
355 |
+
selected_config_name = st.selectbox(
|
356 |
+
"Select File Type Configuration:",
|
357 |
+
config_names,
|
358 |
+
format_func=lambda x: config_manager.get_config(x)['name'] if config_manager.get_config(x) else x,
|
359 |
+
help="Choose a predefined configuration or create a new one"
|
360 |
+
)
|
361 |
+
with col2:
|
362 |
+
if st.button("🔄 Load Config", help="Load the selected configuration"):
|
363 |
+
config = config_manager.get_config(selected_config_name)
|
364 |
+
if config:
|
365 |
+
# Update fields
|
366 |
+
st.session_state.fields_str = config.get('fields', '')
|
367 |
+
|
368 |
+
# Update field descriptions table
|
369 |
+
field_descs = config.get('field_descriptions', {})
|
370 |
+
st.session_state.field_descriptions_table = []
|
371 |
+
for field_name, field_info in field_descs.items():
|
372 |
+
st.session_state.field_descriptions_table.append({
|
373 |
+
'field_name': field_name,
|
374 |
+
'field_description': field_info.get('description', ''),
|
375 |
+
'format': field_info.get('format', ''),
|
376 |
+
'examples': field_info.get('examples', ''),
|
377 |
+
'possible_values': field_info.get('possible_values', '')
|
378 |
+
})
|
379 |
+
|
380 |
+
# Update unique indices descriptions table
|
381 |
+
unique_descs = config.get('unique_indices_descriptions', {})
|
382 |
+
st.session_state.unique_indices_descriptions_table = []
|
383 |
+
for field_name, field_info in unique_descs.items():
|
384 |
+
st.session_state.unique_indices_descriptions_table.append({
|
385 |
+
'field_name': field_name,
|
386 |
+
'field_description': field_info.get('description', ''),
|
387 |
+
'format': field_info.get('format', ''),
|
388 |
+
'examples': field_info.get('examples', ''),
|
389 |
+
'possible_values': field_info.get('possible_values', '')
|
390 |
+
})
|
391 |
+
|
392 |
+
st.session_state.last_selected_config = selected_config_name
|
393 |
+
st.success(f"✅ Configuration '{config['name']}' loaded successfully!")
|
394 |
+
st.rerun()
|
395 |
+
else:
|
396 |
+
st.error("❌ Failed to load configuration")
|
397 |
+
|
398 |
+
# Clear Configuration Button
|
399 |
+
if st.button("🗑️ Clear All Configuration", help="Clear all configuration and start fresh"):
|
400 |
+
st.session_state.field_descriptions_table = []
|
401 |
+
st.session_state.unique_indices_descriptions_table = []
|
402 |
+
st.session_state.fields_str = ""
|
403 |
+
st.session_state.last_selected_config = ""
|
404 |
+
st.success("✅ Configuration cleared!")
|
405 |
+
st.rerun()
|
406 |
+
|
407 |
+
# ============================================================================
|
408 |
+
# SECTION 4: FIELD DESCRIPTIONS
|
409 |
+
# ============================================================================
|
410 |
+
st.subheader("📝 Field Descriptions")
|
411 |
+
st.markdown("""
|
412 |
+
<div style="background-color: #e8f4fd; padding: 1rem; border-radius: 0.5rem; border-left: 4px solid #1f77b4; color: #333;">
|
413 |
+
<strong>Field Descriptions</strong><br>
|
414 |
+
Add descriptions for the fields you want to extract. These help the system understand what to look for.
|
415 |
+
</div>
|
416 |
+
""", unsafe_allow_html=True)
|
417 |
+
|
418 |
+
# Create the table interface
|
419 |
col1, col2, col3, col4, col5, col6 = st.columns([2, 3, 2, 2, 2, 1])
|
420 |
|
421 |
with col1:
|
422 |
+
st.markdown("**Field Name**")
|
423 |
with col2:
|
424 |
+
st.markdown("**Field Description**")
|
425 |
with col3:
|
426 |
+
st.markdown("**Format**")
|
427 |
with col4:
|
428 |
+
st.markdown("**Examples**")
|
429 |
with col5:
|
430 |
+
st.markdown("**Possible Values**")
|
431 |
with col6:
|
432 |
+
st.markdown("**Actions**")
|
|
|
|
|
433 |
|
434 |
+
# Display existing rows
|
435 |
+
for i, row in enumerate(st.session_state.field_descriptions_table):
|
436 |
+
col1, col2, col3, col4, col5, col6 = st.columns([2, 3, 2, 2, 2, 1])
|
437 |
+
|
438 |
+
with col1:
|
439 |
+
field_name = st.text_input("", value=row.get('field_name', ''), key=f"field_name_{i}")
|
440 |
+
with col2:
|
441 |
+
field_desc = st.text_input("", value=row.get('field_description', ''), key=f"field_desc_{i}")
|
442 |
+
with col3:
|
443 |
+
field_format = st.text_input("", value=row.get('format', ''), key=f"field_format_{i}")
|
444 |
+
with col4:
|
445 |
+
field_examples = st.text_input("", value=row.get('examples', ''), key=f"field_examples_{i}")
|
446 |
+
with col5:
|
447 |
+
field_possible_values = st.text_input("", value=row.get('possible_values', ''), key=f"field_possible_values_{i}")
|
448 |
+
with col6:
|
449 |
+
if st.button("🗑️", key=f"delete_{i}", help="Delete this row"):
|
450 |
+
st.session_state.field_descriptions_table.pop(i)
|
451 |
+
st.rerun()
|
452 |
+
|
453 |
+
# Update the row in session state
|
454 |
+
st.session_state.field_descriptions_table[i] = {
|
455 |
+
'field_name': field_name,
|
456 |
+
'field_description': field_desc,
|
457 |
+
'format': field_format,
|
458 |
+
'examples': field_examples,
|
459 |
+
'possible_values': field_possible_values
|
460 |
+
}
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
461 |
|
462 |
+
# Add new row button
|
463 |
+
if st.button("➕ Add Field Description Row"):
|
464 |
+
st.session_state.field_descriptions_table.append({
|
465 |
+
'field_name': '',
|
466 |
+
'field_description': '',
|
467 |
+
'format': '',
|
468 |
+
'examples': '',
|
469 |
+
'possible_values': ''
|
470 |
+
})
|
471 |
+
st.rerun()
|
472 |
+
|
473 |
+
# ============================================================================
|
474 |
+
# SECTION 5: UNIQUE FIELD DESCRIPTIONS
|
475 |
+
# ============================================================================
|
476 |
+
st.subheader("🔑 Unique Field Descriptions")
|
477 |
+
st.markdown("""
|
478 |
+
<div style="background-color: #fff8e1; padding: 1rem; border-radius: 0.5rem; border-left: 4px solid #ffc107; color: #333;">
|
479 |
+
<strong>Unique Field Descriptions</strong><br>
|
480 |
+
Add descriptions for the unique fields that will be used to identify different combinations in the document.
|
481 |
+
</div>
|
482 |
+
""", unsafe_allow_html=True)
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
483 |
|
484 |
# Create the table interface for unique indices
|
485 |
col1, col2, col3, col4, col5, col6 = st.columns([2, 3, 2, 2, 2, 1])
|
|
|
512 |
with col5:
|
513 |
idx_field_possible_values = st.text_input("", value=row.get('possible_values', ''), key=f"unique_field_possible_values_{i}")
|
514 |
with col6:
|
515 |
+
if st.button("🗑️", key=f"unique_delete_{i}", help="Delete this row"):
|
516 |
st.session_state.unique_indices_descriptions_table.pop(i)
|
517 |
st.rerun()
|
518 |
|
|
|
526 |
}
|
527 |
|
528 |
# Add new row button for unique indices
|
529 |
+
if st.button("➕ Add Unique Field Description Row"):
|
530 |
st.session_state.unique_indices_descriptions_table.append({
|
531 |
'field_name': '',
|
532 |
'field_description': '',
|
|
|
536 |
})
|
537 |
st.rerun()
|
538 |
|
539 |
+
# ============================================================================
|
540 |
+
# SECTION 6: SAVE CONFIGURATION
|
541 |
+
# ============================================================================
|
542 |
+
st.subheader("💾 Save Configuration")
|
543 |
+
st.markdown("""
|
544 |
+
<div style="background-color: #e1f5fe; padding: 1rem; border-radius: 0.5rem; border-left: 4px solid #17a2b8; color: #333;">
|
545 |
+
<strong>Save Current Configuration</strong><br>
|
546 |
+
Save your current configuration as a new file type for future use.
|
547 |
+
</div>
|
548 |
+
""", unsafe_allow_html=True)
|
549 |
+
|
550 |
+
col1, col2 = st.columns([3, 1])
|
551 |
+
with col1:
|
552 |
+
save_config_name = st.text_input(
|
553 |
+
"Configuration Name:",
|
554 |
+
placeholder="Enter a name for this configuration (e.g., 'Biotech Report', 'Clinical Data')",
|
555 |
+
help="Choose a descriptive name that will appear in the dropdown"
|
556 |
+
)
|
557 |
+
with col2:
|
558 |
+
if st.button("💾 Save Config", help="Save the current configuration"):
|
559 |
+
if save_config_name:
|
560 |
+
# Prepare configuration data
|
561 |
+
field_descs = {}
|
562 |
+
for row in st.session_state.field_descriptions_table:
|
563 |
+
if row['field_name']: # Only include rows with field names
|
564 |
+
field_descs[row['field_name']] = {
|
565 |
+
'description': row['field_description'],
|
566 |
+
'format': row['format'],
|
567 |
+
'examples': row['examples'],
|
568 |
+
'possible_values': row['possible_values']
|
569 |
+
}
|
570 |
+
|
571 |
+
# Get unique indices descriptions
|
572 |
+
unique_indices_descs = {}
|
573 |
+
for row in st.session_state.unique_indices_descriptions_table:
|
574 |
+
if row['field_name']: # Only include rows with field names
|
575 |
+
unique_indices_descs[row['field_name']] = {
|
576 |
+
'description': row['field_description'],
|
577 |
+
'format': row['format'],
|
578 |
+
'examples': row['examples'],
|
579 |
+
'possible_values': row['possible_values']
|
580 |
+
}
|
581 |
+
|
582 |
+
# Get fields from unique indices
|
583 |
+
fields_str = ", ".join([row['field_name'] for row in st.session_state.unique_indices_descriptions_table if row['field_name']])
|
584 |
+
|
585 |
+
config_data = {
|
586 |
+
'name': save_config_name,
|
587 |
+
'description': f"Configuration for {save_config_name}",
|
588 |
+
'fields': fields_str,
|
589 |
+
'field_descriptions': field_descs,
|
590 |
+
'unique_indices_descriptions': unique_indices_descs
|
591 |
+
}
|
592 |
+
|
593 |
+
if config_manager.save_config(save_config_name, config_data):
|
594 |
+
st.success(f"✅ Configuration '{save_config_name}' saved successfully!")
|
595 |
+
config_manager.reload_configs()
|
596 |
+
st.rerun()
|
597 |
+
else:
|
598 |
+
st.error("❌ Failed to save configuration")
|
599 |
+
else:
|
600 |
+
st.error("❌ Please enter a configuration name")
|
601 |
+
|
602 |
+
# ============================================================================
|
603 |
+
# SECTION 7: ORIGINAL STRATEGY CONFIGURATION
|
604 |
+
# ============================================================================
|
605 |
+
else: # Original Strategy
|
606 |
+
st.header("⚙️ Step 3: Field Configuration")
|
607 |
+
|
608 |
+
fields_str = st.text_input(
|
609 |
+
"Fields to Extract (comma-separated):",
|
610 |
+
value=st.session_state.fields_str,
|
611 |
+
key="fields_input",
|
612 |
+
help="Enter the field names you want to extract, separated by commas"
|
613 |
+
)
|
614 |
+
st.session_state.fields_str = fields_str
|
615 |
+
|
616 |
+
# ============================================================================
|
617 |
+
# SECTION 8: EXECUTION
|
618 |
+
# ============================================================================
|
619 |
+
st.header("🚀 Step 4: Run Extraction")
|
620 |
+
|
621 |
+
# Convert table to JSON for processing
|
622 |
+
field_descs = {}
|
623 |
+
if st.session_state.field_descriptions_table:
|
624 |
+
for row in st.session_state.field_descriptions_table:
|
625 |
+
if row['field_name']: # Only include rows with field names
|
626 |
+
field_descs[row['field_name']] = {
|
627 |
+
'description': row['field_description'],
|
628 |
+
'format': row['format'],
|
629 |
+
'examples': row['examples'],
|
630 |
+
'possible_values': row['possible_values']
|
631 |
+
}
|
632 |
+
|
633 |
+
# Prepare unique indices for Unique Indices Strategy
|
634 |
+
unique_indices = None
|
635 |
+
unique_indices_descriptions = None
|
636 |
+
if strategy == "Unique Indices Strategy":
|
637 |
# Convert unique indices table to JSON for processing and extract field names
|
638 |
unique_indices_descriptions = {}
|
639 |
unique_indices = []
|
|
|
647 |
'examples': row['examples'],
|
648 |
'possible_values': row['possible_values']
|
649 |
}
|
650 |
+
|
651 |
+
# Status indicator
|
652 |
+
if pdf_file:
|
653 |
+
if strategy == "Original Strategy":
|
654 |
+
field_count = len([f.strip() for f in st.session_state.fields_str.split(",") if f.strip()])
|
655 |
+
st.info(f"📊 Ready to extract {field_count} fields using Original Strategy")
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
656 |
else:
|
657 |
+
unique_count = len(unique_indices) if unique_indices else 0
|
658 |
+
field_count = len(field_descs)
|
659 |
+
st.info(f"📊 Ready to extract {field_count} additional fields for {unique_count} unique combinations using Unique Indices Strategy")
|
660 |
+
|
661 |
+
# Run button
|
662 |
+
if st.button("🚀 Run Extraction", type="primary", disabled=not pdf_file):
|
663 |
+
if not pdf_file:
|
664 |
+
st.error("❌ Please upload a PDF file first")
|
665 |
+
else:
|
666 |
+
# Prepare field list based on strategy
|
667 |
+
if strategy == "Original Strategy":
|
668 |
+
field_list = [f.strip() for f in st.session_state.fields_str.split(",") if f.strip()]
|
669 |
+
else: # Unique Indices Strategy
|
670 |
+
# For Unique Indices Strategy, get fields from the unique indices descriptions table
|
671 |
+
field_list = []
|
672 |
+
if st.session_state.unique_indices_descriptions_table:
|
673 |
+
for row in st.session_state.unique_indices_descriptions_table:
|
674 |
+
if row['field_name']: # Only include rows with field names
|
675 |
+
field_list.append(row['field_name'])
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
676 |
|
677 |
+
try:
|
678 |
+
with st.spinner("Planning …"):
|
679 |
+
# quick first-page text preview to give LLM document context
|
680 |
+
doc = fitz.open(stream=pdf_file.getvalue(), filetype="pdf") # type: ignore[arg-type]
|
681 |
+
preview = "\n".join(page.get_text() for page in doc[:10])[:20000] # first 2 pages, 2k chars
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
682 |
|
683 |
+
# Create a cost tracker for this run
|
684 |
+
cost_tracker = CostTracker()
|
|
|
685 |
|
686 |
+
planner = Planner(cost_tracker=cost_tracker)
|
687 |
+
plan = planner.build_plan(
|
688 |
+
pdf_meta={"filename": pdf_file.name},
|
689 |
+
doc_preview=preview,
|
690 |
+
fields=field_list,
|
691 |
+
field_descs=field_descs,
|
692 |
+
strategy=strategy,
|
693 |
+
unique_indices=unique_indices,
|
694 |
+
unique_indices_descriptions=unique_indices_descriptions
|
695 |
+
)
|
696 |
+
|
697 |
+
# Add a visual separator
|
698 |
+
st.markdown("---")
|
699 |
|
700 |
+
with st.spinner("Executing …"):
|
701 |
+
executor = Executor(settings=settings, cost_tracker=cost_tracker)
|
702 |
+
results, logs = executor.run(plan, pdf_file)
|
|
|
|
|
|
|
|
|
|
|
703 |
|
704 |
+
# Get detailed costs
|
705 |
+
costs = executor.cost_tracker.calculate_current_file_costs()
|
706 |
+
model_cost = costs["openai"]["total_cost"]
|
707 |
+
di_cost = costs["document_intelligence"]["total_cost"]
|
708 |
|
709 |
+
# Add debug logging for cost tracking
|
710 |
+
logger.info(f"Cost tracker debug info:")
|
711 |
+
logger.info(f" LLM input tokens: {executor.cost_tracker.llm_input_tokens}")
|
712 |
+
logger.info(f" LLM output tokens: {executor.cost_tracker.llm_output_tokens}")
|
713 |
+
logger.info(f" DI pages: {executor.cost_tracker.di_pages}")
|
714 |
+
logger.info(f" LLM calls count: {len(executor.cost_tracker.llm_calls)}")
|
715 |
+
logger.info(f" Current file costs: {executor.cost_tracker.current_file_costs}")
|
716 |
+
logger.info(f" Calculated costs: {costs}")
|
717 |
|
718 |
+
# Display detailed costs table
|
719 |
+
st.subheader("Detailed Costs")
|
720 |
+
costs_df = executor.cost_tracker.get_detailed_costs_table()
|
721 |
+
st.dataframe(costs_df, use_container_width=True)
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
722 |
|
723 |
+
st.info(
|
724 |
+
f"LLM input tokens: {executor.cost_tracker.llm_input_tokens}, "
|
725 |
+
f"LLM output tokens: {executor.cost_tracker.llm_output_tokens}, "
|
726 |
+
f"DI pages: {executor.cost_tracker.di_pages}, "
|
727 |
+
f"Model cost: ${model_cost:.4f}, "
|
728 |
+
f"DI cost: ${di_cost:.4f}, "
|
729 |
+
f"Total cost: ${model_cost + di_cost:.4f}"
|
730 |
+
)
|
|
|
|
|
731 |
|
732 |
+
# Add detailed logging about what executor returned
|
733 |
+
logger.info(f"Executor returned results of type: {type(results)}")
|
734 |
+
logger.info(f"Results content: {results}")
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
735 |
|
736 |
+
# Check if results is already a DataFrame
|
737 |
+
if isinstance(results, pd.DataFrame):
|
738 |
+
logger.info(f"Results is already a DataFrame with shape: {results.shape}")
|
739 |
+
logger.info(f"DataFrame columns: {results.columns.tolist()}")
|
740 |
+
logger.info(f"DataFrame head: {results.head()}")
|
741 |
+
df = results
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
742 |
else:
|
743 |
+
logger.info("Results is not a DataFrame, calling flatten_json_response")
|
744 |
+
# Process results using flatten_json_response
|
745 |
+
df = flatten_json_response(results, field_list)
|
746 |
+
|
747 |
+
# Log final DataFrame info
|
748 |
+
logger.info(f"Final DataFrame shape: {df.shape}")
|
749 |
+
logger.info(f"Final DataFrame columns: {df.columns.tolist()}")
|
750 |
+
if not df.empty:
|
751 |
+
logger.info(f"Final DataFrame sample: {df.head()}")
|
752 |
+
|
753 |
+
# Store execution in history
|
754 |
+
execution_record = {
|
755 |
+
"filename": pdf_file.name,
|
756 |
+
"datetime": datetime.now().strftime("%Y-%m-%d %H:%M:%S"),
|
757 |
+
"fields": field_list,
|
758 |
+
"logs": log_capture.get_logs(), # Store the actual logs
|
759 |
+
"results": df.to_dict() if not df.empty else None
|
760 |
+
}
|
761 |
+
st.session_state.execution_history.append(execution_record)
|
762 |
+
log_capture.clear() # Clear logs after storing them
|
763 |
+
|
764 |
+
# ----------------- UI: show execution tree -----------------
|
765 |
+
st.subheader("Execution trace")
|
766 |
+
for log in logs:
|
767 |
+
indent = " " * 4 * log["depth"]
|
768 |
+
# Add error indicator if there was an error
|
769 |
+
error_indicator = "❌ " if log.get("error") else "✓ "
|
770 |
+
# Use a fixed preview text instead of the result
|
771 |
+
with st.expander(f"{indent}{error_indicator}{log['tool']} – Click to view result"):
|
772 |
+
st.markdown(f"**Args**: `{log['args']}`", unsafe_allow_html=True)
|
773 |
+
if log.get("error"):
|
774 |
+
st.error(f"Error: {log['error']}")
|
775 |
+
|
776 |
+
# Special handling for IndexAgent output
|
777 |
+
if log['tool'] == "IndexAgent" and isinstance(log["result"], dict):
|
778 |
+
# Display chunk statistics if available
|
779 |
+
if "chunk_stats" in log["result"]:
|
780 |
+
st.markdown("### Chunk Statistics")
|
781 |
+
# Create a DataFrame for better visualization
|
782 |
+
stats_df = pd.DataFrame(log["result"]["chunk_stats"])
|
783 |
+
st.dataframe(stats_df)
|
784 |
+
|
785 |
+
# Add summary statistics
|
786 |
+
st.markdown("### Summary")
|
787 |
+
st.markdown(f"""
|
788 |
+
- Total chunks: {len(stats_df)}
|
789 |
+
- Average chunk length: {stats_df['length'].mean():.0f} characters
|
790 |
+
- Shortest chunk: {stats_df['length'].min()} characters
|
791 |
+
- Longest chunk: {stats_df['length'].max()} characters
|
792 |
+
""")
|
793 |
+
|
794 |
+
# Add a bar chart of chunk lengths
|
795 |
+
st.markdown("### Chunk Length Distribution")
|
796 |
+
st.bar_chart(stats_df.set_index('chunk_number')['length'])
|
797 |
+
else:
|
798 |
+
st.code(log["result"])
|
799 |
|
800 |
+
if not df.empty:
|
801 |
+
st.success("Done ✓")
|
802 |
+
st.dataframe(df)
|
803 |
+
st.download_button("Download CSV", df.to_csv(index=False), "results.csv")
|
804 |
+
else:
|
805 |
+
st.warning("No results were extracted. Check the execution trace for errors.")
|
806 |
+
except Exception as e:
|
807 |
+
logging.exception("App error:")
|
808 |
+
st.error(f"An error occurred: {e}")
|
src/config/config_manager.py
ADDED
@@ -0,0 +1,148 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
1 |
+
"""Configuration manager for file type configurations."""
|
2 |
+
import yaml
|
3 |
+
import os
|
4 |
+
from pathlib import Path
|
5 |
+
from typing import Dict, Any, List, Optional
|
6 |
+
import logging
|
7 |
+
|
8 |
+
logger = logging.getLogger(__name__)
|
9 |
+
|
10 |
+
class ConfigManager:
|
11 |
+
"""Manages file type configurations."""
|
12 |
+
|
13 |
+
def __init__(self, config_file: str = "file_types.yaml"):
|
14 |
+
self.config_file = Path(__file__).parent / config_file
|
15 |
+
self.configs = self._load_configs()
|
16 |
+
|
17 |
+
def _load_configs(self) -> Dict[str, Any]:
|
18 |
+
"""Load configurations from YAML file."""
|
19 |
+
try:
|
20 |
+
if self.config_file.exists():
|
21 |
+
with open(self.config_file, 'r', encoding='utf-8') as f:
|
22 |
+
configs = yaml.safe_load(f) or {}
|
23 |
+
logger.info(f"Loaded {len(configs)} configurations from {self.config_file}")
|
24 |
+
return configs
|
25 |
+
else:
|
26 |
+
logger.warning(f"Configuration file {self.config_file} not found, creating default")
|
27 |
+
return self._create_default_config()
|
28 |
+
except Exception as e:
|
29 |
+
logger.error(f"Error loading configurations: {e}")
|
30 |
+
return self._create_default_config()
|
31 |
+
|
32 |
+
def _create_default_config(self) -> Dict[str, Any]:
|
33 |
+
"""Create default configuration if file doesn't exist."""
|
34 |
+
default_config = {
|
35 |
+
"default_type": {
|
36 |
+
"name": "Default Type",
|
37 |
+
"description": "Default configuration for biotech documents",
|
38 |
+
"fields": "Chain, Percentage, Seq Loc",
|
39 |
+
"field_descriptions": {
|
40 |
+
"Chain": {
|
41 |
+
"description": "Refers to either the heavy chain (HC) or light chain (LC) of an antibody or protein construct, each analyzed separately for structural integrity and chemical modifications.",
|
42 |
+
"format": "String",
|
43 |
+
"examples": "Heavy",
|
44 |
+
"possible_values": "Heavy, Light"
|
45 |
+
},
|
46 |
+
"Percentage": {
|
47 |
+
"description": "The relative abundance of a specific modification or peptide, typically quantified using extracted ion chromatograms (EICs) and expressed as a percentage of the total signal.",
|
48 |
+
"format": "Float",
|
49 |
+
"examples": "90.0",
|
50 |
+
"possible_values": ""
|
51 |
+
},
|
52 |
+
"Seq Loc": {
|
53 |
+
"description": "The specific amino acid position(s) within the protein sequence where a peptide or modification is located, often denoted by residue numbers and chain type (e.g., HC(88–125)).",
|
54 |
+
"format": "String",
|
55 |
+
"examples": "HC(1-31)",
|
56 |
+
"possible_values": ""
|
57 |
+
}
|
58 |
+
},
|
59 |
+
"unique_indices_descriptions": {
|
60 |
+
"Protein Lot": {
|
61 |
+
"description": "Protein lots are batches of protein constructs analyzed to detect potential liabilities affecting stability, efficacy, and safety. Key liabilities include clipping events, deamidation, cyclization, oxidation, thioether bond formation, and glycation. Analytical methods such as reduced protein analysis by RPLC-UV-MS and peptide map analysis in reducing conditions are used to identify and quantify these modifications.",
|
62 |
+
"format": "String",
|
63 |
+
"examples": "P066_FH0.7-0-hulgG-LALAPG-FJB",
|
64 |
+
"possible_values": ""
|
65 |
+
},
|
66 |
+
"Peptide": {
|
67 |
+
"description": "A fragment of the protein sequence, typically derived from enzymatic digestion, used to detect and localize specific modifications or features.",
|
68 |
+
"format": "String",
|
69 |
+
"examples": "QVQLQQSGPGLVQPSQSLSITCTVSDFSLAR",
|
70 |
+
"possible_values": ""
|
71 |
+
},
|
72 |
+
"Timepoint": {
|
73 |
+
"description": "A designated sampling moment in a stability or stress study, used to track changes in the protein over time under specific conditions.",
|
74 |
+
"format": "String",
|
75 |
+
"examples": "0w",
|
76 |
+
"possible_values": "0w, 2w, 4w, 6w"
|
77 |
+
},
|
78 |
+
"Modification": {
|
79 |
+
"description": "Any chemical or structural alteration to the protein or peptide, such as deamidation, oxidation, clipping, or glycation, which may affect function or stability.",
|
80 |
+
"format": "String",
|
81 |
+
"examples": "deamidation",
|
82 |
+
"possible_values": "Deamidation, Oxidation, Truncation, pyroE, Isomerization, N-glycosylation, NonConforming, pyroQ, Thioether, Clipping, O-glycosylation, Double deamidation"
|
83 |
+
}
|
84 |
+
}
|
85 |
+
}
|
86 |
+
}
|
87 |
+
|
88 |
+
# Save the default configuration
|
89 |
+
self._save_configs(default_config)
|
90 |
+
return default_config
|
91 |
+
|
92 |
+
def _save_configs(self, configs: Dict[str, Any]) -> None:
|
93 |
+
"""Save configurations to YAML file."""
|
94 |
+
try:
|
95 |
+
with open(self.config_file, 'w', encoding='utf-8') as f:
|
96 |
+
yaml.dump(configs, f, default_flow_style=False, allow_unicode=True, sort_keys=False)
|
97 |
+
logger.info(f"Saved {len(configs)} configurations to {self.config_file}")
|
98 |
+
except Exception as e:
|
99 |
+
logger.error(f"Error saving configurations: {e}")
|
100 |
+
|
101 |
+
def get_config_names(self) -> List[str]:
|
102 |
+
"""Get list of available configuration names."""
|
103 |
+
return list(self.configs.keys())
|
104 |
+
|
105 |
+
def get_config(self, config_name: str) -> Optional[Dict[str, Any]]:
|
106 |
+
"""Get a specific configuration by name."""
|
107 |
+
return self.configs.get(config_name)
|
108 |
+
|
109 |
+
def save_config(self, config_name: str, config_data: Dict[str, Any]) -> bool:
|
110 |
+
"""Save a new configuration."""
|
111 |
+
try:
|
112 |
+
# Validate required fields
|
113 |
+
required_fields = ['name', 'fields', 'field_descriptions', 'unique_indices_descriptions']
|
114 |
+
for field in required_fields:
|
115 |
+
if field not in config_data:
|
116 |
+
logger.error(f"Missing required field: {field}")
|
117 |
+
return False
|
118 |
+
|
119 |
+
# Save the configuration
|
120 |
+
self.configs[config_name] = config_data
|
121 |
+
self._save_configs(self.configs)
|
122 |
+
logger.info(f"Saved configuration: {config_name}")
|
123 |
+
return True
|
124 |
+
except Exception as e:
|
125 |
+
logger.error(f"Error saving configuration {config_name}: {e}")
|
126 |
+
return False
|
127 |
+
|
128 |
+
def delete_config(self, config_name: str) -> bool:
|
129 |
+
"""Delete a configuration."""
|
130 |
+
try:
|
131 |
+
if config_name in self.configs:
|
132 |
+
del self.configs[config_name]
|
133 |
+
self._save_configs(self.configs)
|
134 |
+
logger.info(f"Deleted configuration: {config_name}")
|
135 |
+
return True
|
136 |
+
else:
|
137 |
+
logger.warning(f"Configuration {config_name} not found")
|
138 |
+
return False
|
139 |
+
except Exception as e:
|
140 |
+
logger.error(f"Error deleting configuration {config_name}: {e}")
|
141 |
+
return False
|
142 |
+
|
143 |
+
def reload_configs(self) -> None:
|
144 |
+
"""Reload configurations from file."""
|
145 |
+
self.configs = self._load_configs()
|
146 |
+
|
147 |
+
# Global instance
|
148 |
+
config_manager = ConfigManager()
|
src/config/file_types.yaml
ADDED
@@ -0,0 +1,170 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
1 |
+
default_type:
|
2 |
+
name: Default Type
|
3 |
+
description: Default configuration for biotech documents
|
4 |
+
fields: Chain, Percentage, Seq Loc
|
5 |
+
field_descriptions:
|
6 |
+
Chain:
|
7 |
+
description: Refers to either the heavy chain (HC) or light chain (LC) of an
|
8 |
+
antibody or protein construct, each analyzed separately for structural integrity
|
9 |
+
and chemical modifications.
|
10 |
+
format: String
|
11 |
+
examples: Heavy
|
12 |
+
possible_values: Heavy, Light
|
13 |
+
Percentage:
|
14 |
+
description: The relative abundance of a specific modification or peptide, typically
|
15 |
+
quantified using extracted ion chromatograms (EICs) and expressed as a percentage
|
16 |
+
of the total signal.
|
17 |
+
format: Float
|
18 |
+
examples: '90.0'
|
19 |
+
possible_values: ''
|
20 |
+
Seq Loc:
|
21 |
+
description: The specific amino acid position(s) within the protein sequence
|
22 |
+
where a peptide or modification is located, often denoted by residue numbers
|
23 |
+
and chain type (e.g., HC(88–125)).
|
24 |
+
format: String
|
25 |
+
examples: HC(1-31)
|
26 |
+
possible_values: ''
|
27 |
+
unique_indices_descriptions:
|
28 |
+
Protein Lot:
|
29 |
+
description: Protein lots are batches of protein constructs analyzed to detect
|
30 |
+
potential liabilities affecting stability, efficacy, and safety. Key liabilities
|
31 |
+
include clipping events, deamidation, cyclization, oxidation, thioether bond
|
32 |
+
formation, and glycation. Analytical methods such as reduced protein analysis
|
33 |
+
by RPLC-UV-MS and peptide map analysis in reducing conditions are used to
|
34 |
+
identify and quantify these modifications.
|
35 |
+
format: String
|
36 |
+
examples: P066_FH0.7-0-hulgG-LALAPG-FJB
|
37 |
+
possible_values: ''
|
38 |
+
Peptide:
|
39 |
+
description: A fragment of the protein sequence, typically derived from enzymatic
|
40 |
+
digestion, used to detect and localize specific modifications or features.
|
41 |
+
format: String
|
42 |
+
examples: QVQLQQSGPGLVQPSQSLSITCTVSDFSLAR
|
43 |
+
possible_values: ''
|
44 |
+
Timepoint:
|
45 |
+
description: A designated sampling moment in a stability or stress study, used
|
46 |
+
to track changes in the protein over time under specific conditions.
|
47 |
+
format: String
|
48 |
+
examples: 0w
|
49 |
+
possible_values: 0w, 2w, 4w, 6w
|
50 |
+
Modification:
|
51 |
+
description: Any chemical or structural alteration to the protein or peptide,
|
52 |
+
such as deamidation, oxidation, clipping, or glycation, which may affect function
|
53 |
+
or stability.
|
54 |
+
format: String
|
55 |
+
examples: deamidation
|
56 |
+
possible_values: Deamidation, Oxidation, Truncation, pyroE, Isomerization, N-glycosylation,
|
57 |
+
NonConforming, pyroQ, Thioether, Clipping, O-glycosylation, Double deamidation
|
58 |
+
default 2:
|
59 |
+
name: default 2
|
60 |
+
description: Configuration for default 2
|
61 |
+
fields: Protein Lot, Peptide, Timepoint, Modification
|
62 |
+
field_descriptions:
|
63 |
+
Chain:
|
64 |
+
description: Refers to either the heavy chain (HC) or light chain (LC) of an
|
65 |
+
antibody or protein construct, each analyzed separately for structural integrity
|
66 |
+
and chemical modifications.
|
67 |
+
format: String
|
68 |
+
examples: Heavy
|
69 |
+
possible_values: Heavy, Light
|
70 |
+
Percentage:
|
71 |
+
description: The relative abundance of a specific modification or peptide, typically
|
72 |
+
quantified using extracted ion chromatograms (EICs) and expressed as a percentage
|
73 |
+
of the total signal.
|
74 |
+
format: Float
|
75 |
+
examples: '90.0'
|
76 |
+
possible_values: ''
|
77 |
+
Seq Loc:
|
78 |
+
description: The specific amino acid position(s) within the protein sequence
|
79 |
+
where a peptide or modification is located, often denoted by residue numbers
|
80 |
+
and chain type (e.g., HC(88–125)).
|
81 |
+
format: String
|
82 |
+
examples: HC(1-31)
|
83 |
+
possible_values: ''
|
84 |
+
unique_indices_descriptions:
|
85 |
+
Protein Lot:
|
86 |
+
description: Protein lots are batches of protein constructs analyzed to detect
|
87 |
+
potential liabilities affecting stability, efficacy, and safety. Key liabilities
|
88 |
+
include clipping events, deamidation, cyclization, oxidation, thioether bond
|
89 |
+
formation, and glycation. Analytical methods such as reduced protein analysis
|
90 |
+
by RPLC-UV-MS and peptide map analysis in reducing conditions are used to
|
91 |
+
identify and quantify these modifications.
|
92 |
+
format: String
|
93 |
+
examples: P066_FH0.7-0-hulgG-LALAPG-FJB
|
94 |
+
possible_values: ''
|
95 |
+
Peptide:
|
96 |
+
description: A fragment of the protein sequence, typically derived from enzymatic
|
97 |
+
digestion, used to detect and localize specific modifications or features.
|
98 |
+
format: String
|
99 |
+
examples: QVQLQQSGPGLVQPSQSLSITCTVSDFSLAR
|
100 |
+
possible_values: ''
|
101 |
+
Timepoint:
|
102 |
+
description: A designated sampling moment in a stability or stress study, used
|
103 |
+
to track changes in the protein over time under specific conditions.
|
104 |
+
format: String
|
105 |
+
examples: 0w
|
106 |
+
possible_values: 0w, 2w, 4w, 6w
|
107 |
+
Modification:
|
108 |
+
description: Any chemical or structural alteration to the protein or peptide,
|
109 |
+
such as deamidation, oxidation, clipping, or glycation, which may affect function
|
110 |
+
or stability.
|
111 |
+
format: String
|
112 |
+
examples: deamidation
|
113 |
+
possible_values: Deamidation, Oxidation, Truncation, pyroE, Isomerization, N-glycosylation,
|
114 |
+
NonConforming, pyroQ, Thioether, Clipping, O-glycosylation, Double deamidation
|
115 |
+
Shipping DOcument:
|
116 |
+
name: Shipping DOcument
|
117 |
+
description: Configuration for Shipping DOcument
|
118 |
+
fields: 'Storage Condition, Aliquot Volume, lot #'
|
119 |
+
field_descriptions:
|
120 |
+
Customer Code:
|
121 |
+
description: ''
|
122 |
+
format: Integer
|
123 |
+
examples: '3060'
|
124 |
+
possible_values: ''
|
125 |
+
Stability Protocol:
|
126 |
+
description: ''
|
127 |
+
format: String
|
128 |
+
examples: SGTS-38321
|
129 |
+
possible_values: ''
|
130 |
+
Timepoint:
|
131 |
+
description: ''
|
132 |
+
format: String
|
133 |
+
examples: T=12M
|
134 |
+
possible_values: ''
|
135 |
+
Test:
|
136 |
+
description: ''
|
137 |
+
format: String
|
138 |
+
examples: ''
|
139 |
+
possible_values: ''
|
140 |
+
Aliquot Container:
|
141 |
+
description: ''
|
142 |
+
format: String
|
143 |
+
examples: PP Tube
|
144 |
+
possible_values: ''
|
145 |
+
Shipping Temperature:
|
146 |
+
description: ''
|
147 |
+
format: String
|
148 |
+
examples: <=65
|
149 |
+
possible_values: ''
|
150 |
+
LIMS ID:
|
151 |
+
description: ''
|
152 |
+
format: String
|
153 |
+
examples: '2244197'
|
154 |
+
possible_values: ''
|
155 |
+
unique_indices_descriptions:
|
156 |
+
Storage Condition:
|
157 |
+
description: The degrees on which the product is stored
|
158 |
+
format: String
|
159 |
+
examples: -70 deg C, +5 degC
|
160 |
+
possible_values: ''
|
161 |
+
Aliquot Volume:
|
162 |
+
description: ''
|
163 |
+
format: String
|
164 |
+
examples: 1 x 2mL
|
165 |
+
possible_values: ''
|
166 |
+
'lot #':
|
167 |
+
description: ''
|
168 |
+
format: Integer
|
169 |
+
examples: '2244197'
|
170 |
+
possible_values: ''
|
src/config/settings.py
CHANGED
@@ -17,7 +17,7 @@ class Settings(BaseSettings):
|
|
17 |
AZURE_OPENAI_EMBEDDING_MODEL: str = Field("text-embedding-3-small", env="AZURE_OPENAI_EMBEDDING_MODEL")
|
18 |
|
19 |
# Retry configuration
|
20 |
-
LLM_MAX_RETRIES: int = Field(
|
21 |
LLM_BASE_DELAY: float = Field(1.0, env="LLM_BASE_DELAY")
|
22 |
LLM_MAX_DELAY: float = Field(60.0, env="LLM_MAX_DELAY")
|
23 |
|
|
|
17 |
AZURE_OPENAI_EMBEDDING_MODEL: str = Field("text-embedding-3-small", env="AZURE_OPENAI_EMBEDDING_MODEL")
|
18 |
|
19 |
# Retry configuration
|
20 |
+
LLM_MAX_RETRIES: int = Field(=, env="LLM_MAX_RETRIES")
|
21 |
LLM_BASE_DELAY: float = Field(1.0, env="LLM_BASE_DELAY")
|
22 |
LLM_MAX_DELAY: float = Field(60.0, env="LLM_MAX_DELAY")
|
23 |
|
src/orchestrator/__pycache__/planner.cpython-312.pyc
CHANGED
Binary files a/src/orchestrator/__pycache__/planner.cpython-312.pyc and b/src/orchestrator/__pycache__/planner.cpython-312.pyc differ
|
|
src/services/__pycache__/llm_client.cpython-312.pyc
CHANGED
Binary files a/src/services/__pycache__/llm_client.cpython-312.pyc and b/src/services/__pycache__/llm_client.cpython-312.pyc differ
|
|