Spaces:
Sleeping
Sleeping
| import glob | |
| import smtplib | |
| from datetime import datetime, timedelta | |
| import itertools | |
| import textwrap | |
| from email.mime.multipart import MIMEMultipart | |
| from email.mime.text import MIMEText | |
| from email.utils import formatdate, make_msgid | |
| from functools import cache | |
| from math import pi | |
| from time import sleep, time | |
| from uuid import uuid4 | |
| import io | |
| import os | |
| from pathlib import Path | |
| import sys | |
| import pytz | |
| from Bio import SeqIO | |
| from Bio.Align import PairwiseAligner | |
| from email_validator import validate_email, EmailNotValidError | |
| import gradio as gr | |
| import hydra | |
| import pandas as pd | |
| from pandarallel import pandarallel | |
| import requests | |
| from requests.adapters import HTTPAdapter, Retry | |
| from markdown import markdown | |
| from rdkit import Chem, DataStructs | |
| from rdkit.Chem import Draw, RDConfig, PandasTools, Descriptors, rdMolDescriptors, rdmolops, Lipinski, Crippen, AllChem | |
| from rdkit.Chem.Scaffolds import MurckoScaffold | |
| import seaborn as sns | |
| from bokeh.models import Legend, NumberFormatter, BooleanFormatter, HTMLTemplateFormatter, LegendItem | |
| from bokeh.palettes import Category20c_20 | |
| from bokeh.plotting import figure | |
| from bokeh.transform import cumsum | |
| from bokeh.resources import INLINE | |
| import panel as pn | |
| from apscheduler.schedulers.background import BackgroundScheduler | |
| from tinydb import TinyDB, Query | |
| # import swifter | |
| from tqdm.auto import tqdm | |
| from deepscreen.data.dti import validate_seq_str, rdkit_canonicalize, FASTA_PAT, SMILES_PAT | |
| from deepscreen.predict import predict | |
| sys.path.append(os.path.join(RDConfig.RDContribDir, 'SA_Score')) | |
| import sascorer | |
| DATASET_MAX_LEN = 10_000 | |
| SERVER_DATA_DIR = os.getenv('DATA') # '/data' | |
| DB_EXPIRY = timedelta(hours=48).total_seconds() | |
| CSS = """ | |
| .help-tip { | |
| position: absolute; | |
| display: inline-block; | |
| top: 16px; | |
| right: 0px; | |
| text-align: center; | |
| border-radius: 40%; | |
| /* border: 2px solid darkred; background-color: #8B0000;*/ | |
| width: 24px; | |
| height: 24px; | |
| font-size: 16px; | |
| line-height: 26px; | |
| cursor: default; | |
| transition: all 0.5s cubic-bezier(0.55, 0, 0.1, 1); | |
| z-index: 100 !important; | |
| } | |
| .help-tip:hover { | |
| cursor: pointer; | |
| /*background-color: #ccc;*/ | |
| } | |
| .help-tip:before { | |
| content: '?'; | |
| font-weight: 700; | |
| color: #8B0000; | |
| z-index: 100 !important; | |
| } | |
| .help-tip p { | |
| visibility: hidden; | |
| opacity: 0; | |
| text-align: left; | |
| background-color: #EFDDE3; | |
| padding: 20px; | |
| width: 300px; | |
| position: absolute; | |
| border-radius: 4px; | |
| right: -4px; | |
| color: #494F5A; | |
| font-size: 13px; | |
| line-height: normal; | |
| transform: scale(0.7); | |
| transform-origin: 100% 0%; | |
| transition: all 0.5s cubic-bezier(0.55, 0, 0.1, 1); | |
| z-index: 100; | |
| } | |
| .help-tip:hover p { | |
| cursor: default; | |
| visibility: visible; | |
| opacity: 1; | |
| transform: scale(1.0); | |
| } | |
| .help-tip p:before { | |
| position: absolute; | |
| content: ''; | |
| width: 0; | |
| height: 0; | |
| border: 6px solid transparent; | |
| border-bottom-color: #EFDDE3; | |
| right: 10px; | |
| top: -12px; | |
| } | |
| .help-tip p:after { | |
| width: 100%; | |
| height: 40px; | |
| content: ''; | |
| position: absolute; | |
| top: -5px; | |
| left: 0; | |
| z-index: 101; | |
| } | |
| .upload_button { | |
| background-color: #008000; | |
| } | |
| .absolute { | |
| position: absolute; | |
| } | |
| .example { | |
| padding: 0; | |
| background: none; | |
| border: none; | |
| text-decoration: underline; | |
| box-shadow: none; | |
| text-align: left !important; | |
| display: inline-block !important; | |
| } | |
| footer { | |
| visibility: hidden | |
| } | |
| """ | |
| class HelpTip: | |
| def __new__(cls, text): | |
| return gr.HTML( | |
| # elem_classes="absolute", | |
| value=f'<div class="help-tip"><p>{text}</p>', | |
| ) | |
| TASK_MAP = { | |
| 'Compound-Protein Interaction': 'DTI', | |
| 'Compound-Protein Binding Affinity': 'DTA', | |
| } | |
| TASK_METRIC_MAP = { | |
| 'DTI': 'AUROC', | |
| 'DTA': 'CI', | |
| } | |
| PRESET_MAP = { | |
| 'DeepDTA': 'deep_dta', | |
| 'DeepConvDTI': 'deep_conv_dti', | |
| 'GraphDTA': 'graph_dta', | |
| 'MGraphDTA': 'm_graph_dta', | |
| 'HyperAttentionDTI': 'hyper_attention_dti', | |
| 'MolTrans': 'mol_trans', | |
| 'TransformerCPI': 'transformer_cpi', | |
| 'TransformerCPI2': 'transformer_cpi_2', | |
| 'DrugBAN': 'drug_ban', | |
| 'DrugVQA-Seq': 'drug_vqa' | |
| } | |
| TARGET_FAMILY_MAP = { | |
| 'General': 'general', | |
| 'Kinase': 'kinase', | |
| 'Non-Kinase Enzyme': 'non_kinase_enzyme', | |
| 'Membrane Receptor': 'membrane_receptor', | |
| 'Nuclear Receptor': 'nuclear_receptor', | |
| 'Ion Channel': 'ion_channel', | |
| 'Others': 'others', | |
| # 'general': 'general', | |
| # 'kinase': 'kinase', | |
| # 'non-kinase enzyme': 'non_kinase_enzyme', | |
| # 'membrane receptor': 'membrane_receptor', | |
| # 'nuclear Receptor': 'nuclear_receptor', | |
| # 'ion channel': 'ion_channel', | |
| # 'others': 'others', | |
| } | |
| TARGET_LIBRARY_MAP = { | |
| 'DrugBank (Human)': 'drugbank_targets.csv', | |
| 'ChEMBL33 (Human)': 'ChEMBL33_human_proteins.csv', | |
| } | |
| DRUG_LIBRARY_MAP = { | |
| 'DrugBank (Human)': 'drugbank_compounds.csv', | |
| 'Drug Repurposing Hub': 'drug_repurposing_hub.csv' | |
| } | |
| COLUMN_ALIASES = { | |
| 'X1': 'Compound SMILES', | |
| 'X2': 'Target FASTA', | |
| 'ID1': 'Compound ID', | |
| 'ID2': 'Target ID', | |
| 'Y': 'Actual CPI/CPA', | |
| 'Y^': 'Predicted CPI/CPA', | |
| } | |
| pd.set_option('display.float_format', '{:.3f}'.format) | |
| PandasTools.molRepresentation = 'svg' | |
| PandasTools.drawOptions = Draw.rdMolDraw2D.MolDrawOptions() | |
| PandasTools.drawOptions.clearBackground = False | |
| PandasTools.drawOptions.bondLineWidth = 1 | |
| PandasTools.drawOptions.explicitMethyl = True | |
| PandasTools.drawOptions.singleColourWedgeBonds = True | |
| PandasTools.drawOptions.useCDKAtomPalette() | |
| PandasTools.molSize = (100, 64) | |
| session = requests.Session() | |
| ADAPTER = HTTPAdapter(max_retries=Retry(total=5, backoff_factor=0.1, status_forcelist=[500, 502, 503, 504])) | |
| session.mount('http://', ADAPTER) | |
| session.mount('https://', ADAPTER) | |
| db = TinyDB(f'{SERVER_DATA_DIR}/db.json') | |
| # Set all RUNNING jobs to FAILED at TinyDB initialization | |
| Job = Query() | |
| jobs = db.all() | |
| for job in jobs: | |
| if job['status'] == 'RUNNING': | |
| db.update({'status': 'FAILED'}, Job.id == job['id']) | |
| scheduler = BackgroundScheduler() | |
| def remove_job_record(job_id): | |
| # Delete the job from the database | |
| db.remove(Job.id == job_id) | |
| # Delete the corresponding files | |
| files = glob.glob(f"{SERVER_DATA_DIR}/{job_id}*") | |
| for file_path in files: | |
| if os.path.exists(file_path): | |
| os.remove(file_path) | |
| def check_expiry(): | |
| Job = Query() | |
| jobs = db.all() | |
| for job in jobs: | |
| # Check if the job has expired | |
| if job['status'] != 'RUNNING': | |
| expiry_time = job['expiry_time'] if job['expiry_time'] is not None else job['start_time'] + DB_EXPIRY | |
| if expiry_time < time(): | |
| # Delete the job from the database | |
| db.remove(Job.id == job['id']) | |
| # Delete the corresponding file | |
| files = glob.glob(f"{SERVER_DATA_DIR}/{job['id']}*") | |
| for file_path in files: | |
| if os.path.exists(file_path): | |
| os.remove(file_path) | |
| elif job['status'] == 'RUNNING' and time() - job['start_time'] > 4 * 60 * 60: # 4 hours | |
| # Mark the job as failed | |
| db.update({'status': 'FAILED', | |
| 'error': 'Job has timed out by exceeding the maximum running time of 4 hours.'}, | |
| Job.id == job['id']) | |
| if job.get('email'): | |
| send_email(job) | |
| def max_tanimoto_similarity(smi, seen_smiles): | |
| if smi is None: | |
| return 0 | |
| mol = Chem.MolFromSmiles(smi) | |
| if mol is None: | |
| return 0 | |
| mol_ecfp = AllChem.GetMorganFingerprintAsBitVect(mol, radius=2, nBits=2048) | |
| max_sim = 0 | |
| for smiles in seen_smiles: | |
| mol_seen = Chem.MolFromSmiles(smiles) | |
| mol_seen_ecfp = AllChem.GetMorganFingerprintAsBitVect(mol_seen, radius=2, nBits=2048) | |
| sim = DataStructs.TanimotoSimilarity(mol_ecfp, mol_seen_ecfp) | |
| if sim == 1: | |
| return 1 | |
| max_sim = max(sim, max_sim) | |
| return max_sim | |
| def max_sequence_identity(seq, seen_fastas): | |
| if seq is None: | |
| return 0 | |
| aligner = PairwiseAligner() | |
| aligner.mode = 'local' | |
| max_id = 0 | |
| for fasta in seen_fastas: | |
| alignment = aligner.align(seq, fasta) | |
| identity = alignment.score / max(len(seq), len(fasta)) | |
| if identity == 1: | |
| return 1 | |
| max_id = max(identity, max_id) | |
| return max_id | |
| def get_seen_smiles(family, task): | |
| seen_smiles = pd.read_csv( | |
| f'data/benchmarks/seen_compounds/{TARGET_FAMILY_MAP[family.title()]}_{task.lower()}_random_split.csv') | |
| return seen_smiles['X1'].tolist() | |
| def get_seen_fastas(family, task): | |
| seen_fastas = pd.read_csv( | |
| f'data/benchmarks/seen_targets/{TARGET_FAMILY_MAP[family.title()]}_{task.lower()}_random_split.csv') | |
| return seen_fastas['X2'].tolist() | |
| def get_fasta_family_map(): | |
| usecols = ['X2', 'ID2', 'Target Family'] | |
| fasta_family_map = pd.concat([ | |
| pd.read_csv('data/target_libraries/ChEMBL33_all_spe_single_prot_info.csv', usecols=usecols), | |
| pd.read_csv('data/target_libraries/idmapping_not_in_chembl.csv', usecols=usecols) | |
| ]).drop_duplicates(subset=['X2'], keep='first') | |
| return fasta_family_map | |
| def lipinski(mol): | |
| """ | |
| Lipinski's rules: | |
| Hydrogen bond donors <= 5 | |
| Hydrogen bond acceptors <= 10 | |
| Molecular weight <= 500 daltons | |
| logP <= 5 | |
| """ | |
| return ( | |
| Lipinski.NumHDonors(mol) <= 5 and | |
| Lipinski.NumHAcceptors(mol) <= 10 and | |
| Descriptors.MolWt(mol) <= 500 and | |
| Crippen.MolLogP(mol) <= 5 | |
| ) | |
| def reos(mol): | |
| """ | |
| Rapid Elimination Of Swill filter: | |
| Molecular weight between 200 and 500 | |
| LogP between -5.0 and +5.0 | |
| H-bond donor count between 0 and 5 | |
| H-bond acceptor count between 0 and 10 | |
| Formal charge between -2 and +2 | |
| Rotatable bond count between 0 and 8 | |
| Heavy atom count between 15 and 50 | |
| """ | |
| return ( | |
| 200 <= Descriptors.MolWt(mol) <= 500 and | |
| -5.0 <= Crippen.MolLogP(mol) <= 5.0 and | |
| 0 <= Lipinski.NumHDonors(mol) <= 5 and | |
| 0 <= Lipinski.NumHAcceptors(mol) <= 10 and | |
| -2 <= rdmolops.GetFormalCharge(mol) <= 2 and | |
| 0 <= rdMolDescriptors.CalcNumRotatableBonds(mol) <= 8 and | |
| 15 <= rdMolDescriptors.CalcNumHeavyAtoms(mol) <= 50 | |
| ) | |
| def ghose(mol): | |
| """ | |
| Ghose drug like filter: | |
| Molecular weight between 160 and 480 | |
| LogP between -0.4 and +5.6 | |
| Atom count between 20 and 70 | |
| Molar refractivity between 40 and 130 | |
| """ | |
| return ( | |
| 160 <= Descriptors.MolWt(mol) <= 480 and | |
| -0.4 <= Crippen.MolLogP(mol) <= 5.6 and | |
| 20 <= rdMolDescriptors.CalcNumAtoms(mol) <= 70 and | |
| 40 <= Crippen.MolMR(mol) <= 130 | |
| ) | |
| def veber(mol): | |
| """ | |
| The Veber filter is a rule of thumb filter for orally active drugs described in | |
| Veber et al., J Med Chem. 2002; 45(12): 2615-23.: | |
| Rotatable bonds <= 10 | |
| Topological polar surface area <= 140 | |
| """ | |
| return ( | |
| rdMolDescriptors.CalcNumRotatableBonds(mol) <= 10 and | |
| rdMolDescriptors.CalcTPSA(mol) <= 140 | |
| ) | |
| def rule_of_three(mol): | |
| """ | |
| Rule of Three filter (Congreve et al., Drug Discov. Today. 8 (19): 876–7, (2003).): | |
| Molecular weight <= 300 | |
| LogP <= 3 | |
| H-bond donor <= 3 | |
| H-bond acceptor count <= 3 | |
| Rotatable bond count <= 3 | |
| """ | |
| return ( | |
| Descriptors.MolWt(mol) <= 300 and | |
| Crippen.MolLogP(mol) <= 3 and | |
| Lipinski.NumHDonors(mol) <= 3 and | |
| Lipinski.NumHAcceptors(mol) <= 3 and | |
| rdMolDescriptors.CalcNumRotatableBonds(mol) <= 3 | |
| ) | |
| def load_smarts_patterns(smarts_path): | |
| # Load the CSV file containing SMARTS patterns | |
| smarts_df = pd.read_csv(Path(smarts_path)) | |
| # Convert all SMARTS patterns to molecules | |
| smarts_mols = [Chem.MolFromSmarts(smarts) for smarts in smarts_df['smarts']] | |
| return smarts_mols | |
| def smarts_filter(mol, smarts_mols): | |
| for smarts_mol in smarts_mols: | |
| if smarts_mol is not None and mol.HasSubstructMatch(smarts_mol): | |
| return False | |
| return True | |
| def pains(mol): | |
| smarts_mols = load_smarts_patterns("data/filters/pains.csv") | |
| return smarts_filter(mol, smarts_mols) | |
| def mlsmr(mol): | |
| smarts_mols = load_smarts_patterns("data/filters/mlsmr.csv") | |
| return smarts_filter(mol, smarts_mols) | |
| def dundee(mol): | |
| smarts_mols = load_smarts_patterns("data/filters/dundee.csv") | |
| return smarts_filter(mol, smarts_mols) | |
| def glaxo(mol): | |
| smarts_mols = load_smarts_patterns("data/filters/glaxo.csv") | |
| return smarts_filter(mol, smarts_mols) | |
| def bms(mol): | |
| smarts_mols = load_smarts_patterns("data/filters/bms.csv") | |
| return smarts_filter(mol, smarts_mols) | |
| SCORE_MAP = { | |
| 'SAscore': sascorer.calculateScore, | |
| 'LogP': Crippen.MolLogP, | |
| 'Molecular Weight': Descriptors.MolWt, | |
| 'Number of Atoms': rdMolDescriptors.CalcNumAtoms, | |
| 'Number of Heavy Atoms': rdMolDescriptors.CalcNumHeavyAtoms, | |
| 'Molar Refractivity': Crippen.MolMR, | |
| 'H-Bond Donor Count': Lipinski.NumHDonors, | |
| 'H-Bond Acceptor Count': Lipinski.NumHAcceptors, | |
| 'Rotatable Bond Count': rdMolDescriptors.CalcNumRotatableBonds, | |
| 'Topological Polar Surface Area': rdMolDescriptors.CalcTPSA, | |
| } | |
| FILTER_MAP = { | |
| # TODO support number_of_violations | |
| 'REOS': reos, | |
| "Lipinski's Rule of Five": lipinski, | |
| 'Ghose': ghose, | |
| 'Rule of Three': rule_of_three, | |
| 'Veber': veber, | |
| 'PAINS': pains, | |
| 'MLSMR': mlsmr, | |
| 'Dundee': dundee, | |
| 'Glaxo': glaxo, | |
| 'BMS': bms, | |
| } | |
| def validate_columns(df, mandatory_cols): | |
| missing_cols = [col for col in mandatory_cols if col not in df.columns] | |
| if missing_cols: | |
| error_message = (f"The following mandatory columns are missing " | |
| f"in the uploaded dataset: {str(mandatory_cols).strip('[]')}.") | |
| raise ValueError(error_message) | |
| else: | |
| return | |
| def process_target_fasta(sequence): | |
| try: | |
| if sequence: | |
| lines = sequence.strip().split("\n") | |
| if lines[0].startswith(">"): | |
| lines = lines[1:] | |
| return ''.join(lines).split(">")[0] | |
| # record = list(SeqIO.parse(io.StringIO(sequence), "fasta"))[0] | |
| # return str(record.seq) | |
| else: | |
| raise ValueError('Empty FASTA sequence.') | |
| except Exception as e: | |
| raise gr.Error(f'Failed to process FASTA due to error: {str(e)}') | |
| def send_email(job_info): | |
| if job_info.get('email'): | |
| try: | |
| email_info = job_info.copy() | |
| email_serv = os.getenv('EMAIL_SERV') | |
| email_port = os.getenv('EMAIL_PORT') | |
| email_addr = os.getenv('EMAIL_ADDR') | |
| email_pass = os.getenv('EMAIL_PASS') | |
| email_form = os.getenv('EMAIL_FORM') | |
| email_subj = os.getenv('EMAIL_SUBJ') | |
| for key, value in email_info.items(): | |
| if key.endswith("time") and value: | |
| email_info[key] = ts_to_str(value, get_timezone_by_ip(email_info['ip'])) | |
| server = smtplib.SMTP(email_serv, int(email_port)) | |
| # server.starttls() | |
| server.login(email_addr, email_pass) | |
| msg = MIMEMultipart("alternative") | |
| msg["From"] = email_addr | |
| msg["To"] = email_info['email'] | |
| msg["Subject"] = email_subj.format(**email_info) | |
| msg["Date"] = formatdate(localtime=True) | |
| msg["Message-ID"] = make_msgid() | |
| msg.attach(MIMEText(markdown(email_form.format(**email_info)), 'html')) | |
| msg.attach(MIMEText(email_form.format(**email_info), 'plain')) | |
| server.sendmail(email_addr, email_info['email'], msg.as_string()) | |
| server.quit() | |
| gr.Info('Email notification sent.') | |
| except Exception as e: | |
| gr.Warning('Failed to send email notification due to error: ' + str(e)) | |
| def check_user_running_job(email, request): | |
| message = ("You already have a running prediction job (ID: {id}) under this {reason}. " | |
| "Please wait for it to complete before submitting another job.") | |
| try: | |
| # with open('jobs.json', 'r') as f: # /data/ | |
| # # Load the JSON data from the file | |
| # jobs = json.load(f) | |
| # | |
| # for job_id, job_info in jobs.items(): | |
| # # check if a job is running for the email | |
| # if email: | |
| # if job_info["email"] == email and job_info["status"] == "running": | |
| # return message.format(id=job_id, reason="email") | |
| # # check if a job is running for the session | |
| # elif request.cookies: | |
| # for key, value in job_info["cookies"].items() and job_info["status"] == "running": | |
| # if key in request.cookies and request.cookies[key] == value: | |
| # return message.format(id=job_id, reason="session") | |
| # # check if a job is running for the IP | |
| # else: | |
| # if job_info["IP"] == request.client.host and job_info["status"] == "running": | |
| # return message.format(id=job_id, reason="IP") | |
| # check if a job is running for the email | |
| Job = Query() | |
| if email: | |
| job = db.search((Job.email == email) & (Job.status == "RUNNING")) | |
| if job: | |
| return message.format(id=job[0]['id'], reason="email") | |
| # check if a job is running for the session | |
| elif request.cookies: | |
| for key, value in request.cookies.items(): | |
| job = db.search((Job.cookies[key] == value) & (Job.status == "RUNNING")) | |
| if job: | |
| return message.format(id=job[0]['id'], reason="session") | |
| # check if a job is running for the IP | |
| else: | |
| job = db.search((Job.IP == request.client.host) & (Job.status == "RUNNING")) | |
| if job: | |
| return message.format(id=job[0]['id'], reason="IP") | |
| return False | |
| except Exception as e: | |
| raise gr.Error(f'Failed to validate user running jobs due to error: {str(e)}') | |
| def get_timezone_by_ip(ip): | |
| try: | |
| data = session.get(f'https://worldtimeapi.org/api/ip/{ip}').json() | |
| return data['timezone'] | |
| except Exception: | |
| return 'UTC' | |
| def ts_to_str(timestamp, timezone): | |
| # Create a timezone-aware datetime object from the UNIX timestamp | |
| dt = datetime.fromtimestamp(timestamp, pytz.utc) | |
| # Convert the timezone-aware datetime object to the target timezone | |
| target_timezone = pytz.timezone(timezone) | |
| localized_dt = dt.astimezone(target_timezone) | |
| # Format the datetime object to the specified string format | |
| return localized_dt.strftime('%Y-%m-%d %H:%M:%S (%Z%z)') | |
| def lookup_job(job_id): | |
| gr.Info('Start querying the job database...') | |
| stop = False | |
| while not stop: | |
| try: | |
| Job = Query() | |
| jobs = db.search((Job.id == job_id)) | |
| if jobs: | |
| job = jobs[0] | |
| job_status = job['status'] | |
| job_type = job['type'] | |
| error = job['error'] | |
| start_time = ts_to_str(job['start_time'], get_timezone_by_ip(job['ip'])) | |
| if job.get('end_time'): | |
| end_time = ts_to_str(job['end_time'], get_timezone_by_ip(job['ip'])) | |
| if job.get('expiry_time'): | |
| expiry_time = ts_to_str(job['expiry_time'], get_timezone_by_ip(job['ip'])) | |
| if job_status == "RUNNING": | |
| sleep(5) | |
| yield { | |
| pred_lookup_status: f''' | |
| Your **{job_type}** job (ID: {job_id}) started at | |
| **{start_time}** and is **RUNNING...** | |
| It might take a few minutes up to a few hours depending on the prediction dataset, the model, and the queue status. | |
| You may keep the page open and wait for the completion, or close the page and revisit later to look up the job status | |
| using the job id. You will also receive an email notification once the job is done. | |
| ''', | |
| pred_lookup_btn: gr.Button(visible=False), | |
| pred_lookup_stop_btn: gr.Button(visible=True) | |
| } | |
| if job_status == "COMPLETED": | |
| stop = True | |
| msg = f"Your {job_type} job (ID: {job_id}) has been **COMPLETED**" | |
| msg += f" at {end_time}" if job.get('end_time') else "" | |
| msg += f" and the results will expire by {expiry_time}." if job.get('expiry_time') else "." | |
| msg += f' Redirecting to the report page...' | |
| gr.Info(msg) | |
| yield { | |
| pred_lookup_status: msg, | |
| pred_lookup_btn: gr.Button(visible=True), | |
| pred_lookup_stop_btn: gr.Button(visible=False), | |
| tabs: gr.Tabs(selected='Chemical Property Report'), | |
| file_for_report: job['output_file'] | |
| } | |
| if job_status == "FAILED": | |
| stop = True | |
| msg = f'Your {job_type} job (ID: {job_id}) has **FAILED**' | |
| msg += f' at {end_time}' if job.get('end_time') else '' | |
| msg += f' due to error: {error}.' if job.get('expiry_time') else '.' | |
| gr.Info(msg) | |
| yield { | |
| pred_lookup_status: msg, | |
| pred_lookup_btn: gr.Button(visible=True), | |
| pred_lookup_stop_btn: gr.Button(visible=False), | |
| tabs: gr.Tabs(selected='Prediction Status Lookup'), | |
| } | |
| else: | |
| stop = True | |
| msg = f'Job ID {job_id} not found.' | |
| gr.Info(msg) | |
| yield { | |
| pred_lookup_status: msg, | |
| pred_lookup_btn: gr.Button(visible=True), | |
| pred_lookup_stop_btn: gr.Button(visible=False), | |
| tabs: gr.Tabs(selected='Prediction Status Lookup'), | |
| } | |
| except Exception as e: | |
| raise gr.Error(f'Failed to retrieve job status due to error: {str(e)}') | |
| def submit_predict(predict_filepath, task, preset, target_family, opts, state): | |
| job_id = state['id'] | |
| status = "RUNNING" | |
| error = None | |
| task_file_abbr = {'Compound-Protein Interaction': 'CPI', 'Compound-Protein Binding Affinity': 'CPA'} | |
| predictions_file = None | |
| df_training = pd.read_csv(f'data/complete_{TASK_MAP[task].lower()}_dataset.csv') | |
| orig_df = pd.read_csv(predict_filepath) | |
| alignment_df = get_fasta_family_map() | |
| prediction_df = pd.DataFrame() | |
| def detect_family(query): | |
| # Check for an exact match first | |
| exact_match = alignment_df[alignment_df['X2'] == query] | |
| if not exact_match.empty: | |
| row = exact_match.iloc[0] | |
| return row['Target Family'] | |
| # If no exact match, then calculate alignment score | |
| else: | |
| aligner = PairwiseAligner(mode='local') | |
| def align_score(target): | |
| alignment = aligner.align(query, target) | |
| return alignment.score / max(len(query), len(target)) | |
| alignment_df['score'] = alignment_df['X2'].apply(align_score) | |
| row = alignment_df.loc[alignment_df['score'].idxmax()] | |
| return row['Target Family'] | |
| if 'Target Family' not in orig_df.columns: | |
| orig_df['Target Family'] = None | |
| orig_df.loc[ | |
| orig_df['Target Family'].isna(), 'Target Family' | |
| ] = orig_df.loc[ | |
| orig_df['Target Family'].isna(), 'X2' | |
| ].parallel_apply(detect_family) | |
| detect_family.cache_clear() | |
| orig_df = orig_df.merge(df_training[['X1', 'X2', 'Y']], on=['X1', 'X2'], how='left', indicator=False) | |
| annotated_df = orig_df[~orig_df['Y'].isna()].copy() | |
| annotated_df.rename(columns={'Y': 'Y^'}, inplace=True) | |
| annotated_df['Prediction Source'] = 'Training Data' | |
| # Resave the unannotated data | |
| unannotated_df = orig_df[orig_df['Y'].isna()].drop(['Y', 'Target Family'], axis=1) | |
| if not unannotated_df.empty: | |
| unannotated_df.to_csv(predict_filepath, index=False, na_rep='') | |
| else: | |
| annotated_df.to_csv(predictions_file, index=False, na_rep='') | |
| status = "COMPLETED" | |
| return {run_state: False} | |
| columns_to_drop = ['ID1', 'Compound', 'Scaffold', 'Scaffold SMILES', 'ID2', 'Y', 'Y^'] | |
| columns_to_drop = [col for col in columns_to_drop if col in orig_df.columns] | |
| orig_df.drop(columns_to_drop, axis=1, inplace=True) | |
| try: | |
| if target_family != 'Family-Specific Auto-Recommendation': | |
| target_family_value = TARGET_FAMILY_MAP[target_family.title()] | |
| task_value = TASK_MAP[task] | |
| preset_value = PRESET_MAP[preset] | |
| predictions_file = (f'{SERVER_DATA_DIR}/' | |
| f'{job_id}_{task_file_abbr[task]}_{preset_value}_{target_family_value}_predictions.csv') | |
| cfg = hydra.compose( | |
| config_name="webserver_inference", | |
| overrides=[f"task={task_value}", | |
| f"preset={preset_value}", | |
| f"ckpt_path=resources/checkpoints/{preset_value}-{task_value}-{target_family_value}.ckpt", | |
| f"data.data_file='{str(predict_filepath)}'"]) | |
| predictions, _ = predict(cfg) | |
| predictions = pd.concat([pd.DataFrame(prediction) for prediction in predictions], ignore_index=True) | |
| predictions['Prediction Source'] = f'{preset} ({target_family})' | |
| prediction_df = pd.concat([prediction_df, predictions]) | |
| else: | |
| predictions_file = f'{SERVER_DATA_DIR}/{job_id}_{task_file_abbr[task]}_{preset}_auto_predictions.csv' | |
| task_value = TASK_MAP[task] | |
| score = TASK_METRIC_MAP[task] | |
| benchmark_df = pd.read_csv(f'data/benchmarks/{task_value}_test_metrics.csv') | |
| predict_df = pd.read_csv(predict_filepath) | |
| for family, subset in predict_df.groupby('Target Family'): | |
| predict_subset_filepath = f'{SERVER_DATA_DIR}/{job_id}_{family}_input.csv' | |
| subset.to_csv(predict_subset_filepath, index=False, na_rep='') | |
| seen_compounds = get_seen_smiles(family, task_value) | |
| if subset['X1'].iloc[0] in seen_compounds['X1'].values: | |
| scenario = "Seen Compound" | |
| else: | |
| scenario = "Unseen Compound" | |
| filtered_df = benchmark_df[(benchmark_df['Family'] == target_family.title()) | |
| & (benchmark_df['Scenario'] == scenario)] | |
| preset = filtered_df.loc[filtered_df[score].idxmax(), 'preset'] | |
| preset_value = PRESET_MAP[preset] | |
| target_family = TARGET_FAMILY_MAP[family.title()] | |
| cfg = hydra.compose( | |
| config_name="webserver_inference", | |
| overrides=[f"task={task_value}", | |
| f"preset={preset_value}", | |
| f"ckpt_path=resources/checkpoints/{preset_value}-{task_value}-{target_family}.ckpt", | |
| f"data.data_file='{str(predict_subset_filepath)}'"]) | |
| predictions, _ = predict(cfg) | |
| predictions = pd.concat([pd.DataFrame(prediction) for prediction in predictions], ignore_index=True) | |
| predictions['Prediction Source'] = f'{preset} ({family})' | |
| prediction_df = pd.concat([prediction_df, predictions]) | |
| prediction_df = prediction_df.merge(orig_df, on=['X1', 'X2'], how='left', indicator=False) | |
| prediction_df = pd.concat([prediction_df, annotated_df], ignore_index=True) | |
| # prediction_df['Max. Tanimoto Similarity'] = prediction_df.groupby('Target Family')['X1'].apply( | |
| # lambda group: group.parallel_apply( | |
| # max_tanimoto_similarity, | |
| # seen_smiles=tuple(get_seen_smiles(family=group.name, task=task_value)) | |
| # ) | |
| # ).values | |
| # | |
| # prediction_df['Max. Sequence Identity'] = prediction_df.groupby('Target Family')['X2'].apply( | |
| # lambda group: group.parallel_apply( | |
| # max_sequence_identity, | |
| # seen_fastas=tuple(get_seen_fastas(family=group.name, task=task_value)) | |
| # ) | |
| # ).values | |
| if "Include Max. Tanimoto Similarity" in opts: | |
| for family in prediction_df['Target Family'].unique(): | |
| prediction_df.loc[ | |
| prediction_df['Target Family'] == family, 'Max. Tanimoto Similarity'] = prediction_df.loc[ | |
| prediction_df['Target Family'] == family, 'X1'].parallel_apply( | |
| max_tanimoto_similarity, | |
| seen_smiles=tuple(get_seen_smiles(family=family, task=task_value)) | |
| ) | |
| if "Include Max. Sequence Identity" in opts: | |
| for family in prediction_df['Target Family'].unique(): | |
| prediction_df.loc[ | |
| prediction_df['Target Family'] == family, 'Max. Sequence Identity'] = prediction_df.loc[ | |
| prediction_df['Target Family'] == family, 'X2'].parallel_apply( | |
| max_sequence_identity, | |
| seen_fastas=tuple(get_seen_fastas(family=family, task=task_value)) | |
| ) | |
| prediction_df.drop(['N'], axis=1).to_csv(predictions_file, index=False, na_rep='') | |
| status = "COMPLETED" | |
| return {run_state: False} | |
| except Exception as e: | |
| gr.Warning(f"Prediction job failed due to error: {str(e)}") | |
| status = "FAILED" | |
| predictions_file = None | |
| error = str(e) | |
| return {run_state: False} | |
| finally: | |
| Job = Query() | |
| job_query = (Job.id == job_id) | |
| end_time = time() | |
| expiry_time = end_time + DB_EXPIRY | |
| db.update({'end_time': end_time, | |
| 'expiry_time': expiry_time, | |
| 'status': status, | |
| 'error': error, | |
| 'input_file': predict_filepath, | |
| 'output_file': predictions_file}, | |
| job_query) | |
| if job_info := db.search(job_query)[0]: | |
| if job_info.get('email'): | |
| send_email(job_info) | |
| def update_df(file, progress=gr.Progress(track_tqdm=True)): | |
| if file and Path(file).is_file(): | |
| task = None | |
| if "_CPI_" in str(file): | |
| task = 'Compound-Protein Interaction' | |
| elif "_CPA_" in str(file): | |
| task = 'Compound-Protein Binding Affinity' | |
| df = pd.read_csv(file) | |
| if 'N' in df.columns: | |
| df.set_index('N', inplace=True) | |
| if not any(col in ['X1', 'X2'] for col in df.columns): | |
| gr.Warning("At least one of columns `X1` and `X2` must be in the uploaded dataset.") | |
| return {analyze_btn: gr.Button(interactive=False)} | |
| if 'X1' in df.columns: | |
| if 'Compound' not in df.columns or df['Compound'].dtype != 'object': | |
| df['Compound'] = df['X1'].parallel_apply( | |
| lambda smiles: PandasTools._MolPlusFingerprint(Chem.MolFromSmiles(smiles))) | |
| df['Scaffold'] = df['Compound'].parallel_apply(MurckoScaffold.GetScaffoldForMol) | |
| df['Scaffold SMILES'] = df['Scaffold'].parallel_apply(lambda x: Chem.MolToSmiles(x)) | |
| # DF_FOR_REPORT = df.copy() | |
| # pie_chart = None | |
| # value = None | |
| # if 'Y^' in DF_FOR_REPORT.columns: | |
| # value = 'Y^' | |
| # elif 'Y' in DF_FOR_REPORT.columns: | |
| # value = 'Y' | |
| # if value: | |
| # if DF_FOR_REPORT['X1'].nunique() > 1 >= DF_FOR_REPORT['X2'].nunique(): | |
| # pie_chart = create_pie_chart(DF_FOR_REPORT, category='Scaffold SMILES', value=value, top_k=100) | |
| # elif DF_FOR_REPORT['X2'].nunique() > 1 >= DF_FOR_REPORT['X1'].nunique(): | |
| # pie_chart = create_pie_chart(DF_FOR_REPORT, category='Target family', value=value, top_k=100) | |
| return {html_report: create_html_report(df, file=None, task=task), | |
| raw_df: df, | |
| report_df: df.copy(), | |
| analyze_btn: gr.Button(interactive=True), | |
| report_task: task} # pie_chart | |
| else: | |
| return {analyze_btn: gr.Button(interactive=False)} | |
| def create_html_report(df, file=None, task=None, opts=(), progress=gr.Progress(track_tqdm=True)): | |
| df_html = df.copy(deep=True) | |
| column_aliases = COLUMN_ALIASES.copy() | |
| cols_left = list(pd.Index( | |
| ['ID1', 'Compound', 'Scaffold', 'Scaffold SMILES', 'ID2', 'Y', 'Y^']).intersection(df_html.columns)) | |
| cols_right = list(pd.Index(['X1', 'X2']).intersection(df_html.columns)) | |
| df_html = df_html[cols_left + (df_html.columns.drop(cols_left + cols_right).tolist()) + cols_right] | |
| if isinstance(task, str): | |
| column_aliases.update({ | |
| 'Y': 'Actual Interaction Probability' if task == 'Compound-Protein Interaction' | |
| else 'Actual Binding Affinity pIC50 [nM]', | |
| 'Y^': 'Predicted Interaction Probability' if task == 'Compound-Protein Interaction' | |
| else 'Predicted Binding Affinity (pIC50 [nM])' | |
| }) | |
| ascending = True if column_aliases['Y^'] == 'Predicted Binding Affinity' else False | |
| df_html = df_html.sort_values( | |
| [col for col in ['Y', 'Y^'] if col in df_html.columns], ascending=ascending | |
| ) | |
| if not file: | |
| df_html = df_html.iloc[:31] | |
| # Remove repeated info for one-against-N tasks to save visual and physical space | |
| job = 'Chemical Property' | |
| unique_entity = 'Unique Entity' | |
| unique_df = None | |
| category = None | |
| columns_unique = None | |
| if 'X1' in df_html.columns and 'X2' in df_html.columns: | |
| n_compound = df_html['X1'].nunique() | |
| n_protein = df_html['X2'].nunique() | |
| if n_compound == 1 and n_protein >= 2: | |
| unique_entity = 'Compound of Interest' | |
| if any(col in df_html.columns for col in ['Y^', 'Y']): | |
| job = 'Target Protein Identification' | |
| category = 'Target Family' | |
| columns_unique = df_html.columns.isin(['X1', 'ID1', 'Scaffold', 'Compound', 'Scaffold SMILES'] | |
| + list(FILTER_MAP.keys()) + list(SCORE_MAP.keys())) | |
| elif n_compound >= 2 and n_protein == 1: | |
| unique_entity = 'Target of Interest' | |
| if any(col in df_html.columns for col in ['Y^', 'Y']): | |
| job = 'Drug Hit Screening' | |
| category = 'Scaffold SMILES' | |
| columns_unique = df_html.columns.isin(['X2', 'ID2']) | |
| elif 'Y^' in df_html.columns: | |
| job = 'Interaction Pair Inference' | |
| if 'Compound' in df_html.columns and 'Exclude Molecular Graph' not in opts: | |
| df_html['Compound'] = df_html['Compound'].parallel_apply( | |
| lambda x: PandasTools.PrintAsImageString(x) if not pd.isna(x) else x) | |
| else: | |
| df_html.drop(['Compound'], axis=1, inplace=True) | |
| if 'Scaffold' in df_html.columns and 'Exclude Scaffold Graph' not in opts: | |
| df_html['Scaffold'] = df_html['Scaffold'].parallel_apply( | |
| lambda x: PandasTools.PrintAsImageString(x) if not pd.isna(x) else x) | |
| else: | |
| df_html.drop(['Scaffold'], axis=1, inplace=True) | |
| df_html.rename(columns=column_aliases, inplace=True) | |
| df_html.index.name = 'Index' | |
| if 'Target FASTA' in df_html.columns: | |
| df_html['Target FASTA'] = df_html['Target FASTA'].parallel_apply( | |
| lambda x: wrap_text(x) if not pd.isna(x) else x) | |
| num_cols = df_html.select_dtypes('number').columns | |
| num_col_colors = sns.color_palette('husl', len(num_cols)) | |
| bool_cols = df_html.select_dtypes(bool).columns | |
| bool_col_colors = {True: 'lightgreen', False: 'lightpink'} | |
| if columns_unique is not None: | |
| unique_df = df_html.loc[:, columns_unique].iloc[[0]].copy() | |
| df_html = df_html.loc[:, ~columns_unique] | |
| if not file: | |
| if 'Compound ID' in df_html.columns: | |
| df_html.drop(['Compound SMILES'], axis=1, inplace=True) | |
| if 'Target ID' in df_html.columns: | |
| df_html.drop(['Target FASTA'], axis=1, inplace=True) | |
| if 'Target FASTA' in df_html.columns: | |
| df_html['Target FASTA'] = df_html['Target FASTA'].parallel_apply( | |
| lambda x: wrap_text(x) if not pd.isna(x) else x) | |
| if 'Scaffold SMILES' in df_html.columns: | |
| df_html.drop(['Scaffold SMILES'], axis=1, inplace=True) | |
| styled_df = df_html.style.format(precision=3) | |
| for i, col in enumerate(num_cols): | |
| if col in df_html.columns: | |
| if col not in ['Predicted Binding Affinity', 'Actual Binding Affinity']: | |
| styled_df = styled_df.background_gradient( | |
| subset=[col], cmap=sns.light_palette(num_col_colors[i], as_cmap=True)) | |
| else: | |
| styled_df = styled_df.background_gradient( | |
| subset=[col], cmap=sns.light_palette(num_col_colors[i], as_cmap=True).reversed()) | |
| if any(df_html.columns.isin(bool_cols)): | |
| styled_df.applymap(lambda val: f'background-color: {bool_col_colors[val]}', subset=bool_cols) | |
| table_html = styled_df.to_html(na_rep='') | |
| unique_html = '' | |
| if unique_df is not None: | |
| if 'Target FASTA' in unique_df.columns: | |
| unique_df['Target FASTA'] = unique_df['Target FASTA'].str.replace('\n', '<br>') | |
| if any(unique_df.columns.isin(bool_cols)): | |
| unique_df = unique_df.style.applymap( | |
| lambda val: f"background-color: {bool_col_colors[val]}", subset=bool_cols) | |
| unique_html = (f'<div style="font-family: Courier !important;">' | |
| f'{unique_df.to_html(escape=False, index=False, na_rep="")}</div>') | |
| return (f'<div style="font-size: 16px; font-weight: bold;">{job} Report Preview (Top 30 Records)</div>' | |
| f'<div style="overflow-x:auto; font-family: Courier !important;">{unique_html}</div>' | |
| f'<div style="overflow:auto; height: 300px; font-family: Courier !important;">{table_html}</div>') | |
| else: | |
| bool_formatters = {col: BooleanFormatter() for col in bool_cols} | |
| float_formatters = {col: NumberFormatter(format='0.000') for col in df_html.select_dtypes('floating').columns} | |
| other_formatters = { | |
| 'Predicted Interaction Probability': {'type': 'progress', 'max': 1.0, 'legend': True}, | |
| 'Actual Interaction Probability': {'type': 'progress', 'max': 1.0, 'legend': True}, | |
| 'Compound': HTMLTemplateFormatter(template='<div class="image-zoom-viewer"><%= value %></div>'), | |
| 'Scaffold': HTMLTemplateFormatter(template='<div class="image-zoom-viewer"><%= value %></div>'), | |
| 'Target FASTA': {'type': 'textarea', 'width': 60}, | |
| 'Target ID': HTMLTemplateFormatter( | |
| template='<a href="<% ' | |
| 'if (/^[OPQ][0-9][A-Z0-9]{3}[0-9]|[A-NR-Z][0-9]([A-Z][A-Z0-9]{2}[0-9]){1,2}$/.test(value)) ' | |
| '{ %>https://www.uniprot.org/uniprotkb/<%= value %><% } ' | |
| 'else { %>https://www.uniprot.org/uniprotkb?query=<%= value %><% } ' | |
| '%>" target="_blank"><%= value %></a>'), | |
| 'Compound ID': HTMLTemplateFormatter( | |
| template='<a href="https://pubchem.ncbi.nlm.nih.gov/compound/<%= value %>" ' | |
| 'target="_blank"><%= value %></a>') | |
| } | |
| formatters = {**bool_formatters, **float_formatters, **other_formatters} | |
| # html = df.to_html(file) | |
| # return html | |
| report_table = pn.widgets.Tabulator( | |
| df_html, formatters=formatters, | |
| frozen_columns=['Index', 'Target ID', 'Compound ID', 'Compound', 'Scaffold'], | |
| disabled=True, sizing_mode='stretch_both', pagination='local', page_size=30) | |
| for i, col in enumerate(num_cols): | |
| if col not in ['Predicted Binding Affinity', 'Actual Binding Affinity']: | |
| if col not in ['Predicted Interaction Probability', 'Actual Interaction Probability']: | |
| report_table.style.background_gradient( | |
| subset=df_html.columns == col, cmap=sns.light_palette(num_col_colors[i], as_cmap=True)) | |
| else: | |
| continue | |
| else: | |
| report_table.style.background_gradient( | |
| subset=df_html.columns == col, cmap=sns.light_palette(num_col_colors[i], as_cmap=True).reversed()) | |
| pie_charts = {} | |
| for y in df_html.columns.intersection(['Predicted Interaction Probability', 'Actual Interaction Probability', | |
| 'Predicted Binding Affinity', 'Actual Binding Affinity']): | |
| pie_charts[y] = [] | |
| for k in [10, 30, 100]: | |
| if k < len(df_html): | |
| pie_charts[y].append(create_pie_chart(df_html, category=category, value=y, top_k=k)) | |
| pie_charts[y].append(create_pie_chart(df_html, category=category, value=y, top_k=len(df_html))) | |
| # Remove keys with empty values | |
| pie_charts = {k: v for k, v in pie_charts.items() if any(v)} | |
| pn_css = """ | |
| .tabulator { | |
| font-family: Courier New !important; | |
| font-weight: normal !important; | |
| font-size: 12px !important; | |
| } | |
| .tabulator-cell { | |
| overflow: visible !important; | |
| } | |
| .tabulator-cell:hover { | |
| z-index: 1000 !important; | |
| } | |
| .tabulator-cell.tabulator-frozen:hover { | |
| z-index: 1000 !important; | |
| } | |
| .image-zoom-viewer { | |
| display: inline-block; | |
| overflow: visible; | |
| z-index: 1000; | |
| } | |
| .image-zoom-viewer::after { | |
| content: ""; | |
| top: 0; | |
| left: 0; | |
| width: 100%; | |
| height: 100%; | |
| pointer-events: none; | |
| } | |
| .image-zoom-viewer:hover::after { | |
| pointer-events: all; | |
| } | |
| /* When hovering over the container, scale its child (the SVG) */ | |
| .tabulator-cell:hover .image-zoom-viewer svg { | |
| padding: 3px; | |
| position: absolute; | |
| background-color: rgba(250, 250, 250, 0.854); | |
| box-shadow: 0 0 10px rgba(0, 0, 0, 0.618); | |
| border-radius: 3px; | |
| transform: scale(3); /* Scale up the SVG */ | |
| transition: transform 0.3s ease; | |
| pointer-events: none; /* Prevents the SVG from blocking mouse interactions */ | |
| z-index: 1000; | |
| } | |
| .image-zoom-viewer svg { | |
| display: block; /* SVG is a block-level element for proper scaling */ | |
| z-index: 1000; | |
| } | |
| .image-zoom-viewer:hover { | |
| z-index: 1000; | |
| } | |
| """ | |
| pn.extension(raw_css=[pn_css]) | |
| template = pn.template.VanillaTemplate( | |
| title=f'DeepSEQreen {job} Report', | |
| sidebar=[], | |
| favicon='deepseqreen.svg', | |
| logo='deepseqreen.svg', | |
| header_background='#F3F5F7', | |
| header_color='#4372c4', | |
| busy_indicator=None, | |
| ) | |
| stats_pane = pn.Row() | |
| if unique_df is not None: | |
| unique_table = pn.widgets.Tabulator(unique_df, formatters=formatters, sizing_mode='stretch_width', | |
| show_index=False, disabled=True, | |
| frozen_columns=['Compound ID', 'Compound', 'Scaffold']) | |
| # if pie_charts: | |
| # unique_table.width = 640 | |
| stats_pane.append(pn.Column(f'### {unique_entity}', unique_table)) | |
| if pie_charts: | |
| for score_name, figure_list in pie_charts.items(): | |
| stats_pane.append( | |
| pn.Column(f'### {category} by Top {score_name}', | |
| pn.Tabs(*figure_list, tabs_location='above')) | |
| # pn.Card(pn.Row(v), title=f'{category} by Top {k}') | |
| ) | |
| if stats_pane: | |
| template.main.append(pn.Card(stats_pane, | |
| sizing_mode='stretch_width', title='Summary Statistics', margin=10)) | |
| template.main.append( | |
| pn.Card(report_table, title=f'{job} Results', # width=1200, | |
| margin=10) | |
| ) | |
| template.save(file, resources=INLINE) | |
| return file | |
| def create_pie_chart(df, category, value, top_k): | |
| if category not in df or value not in df: | |
| return | |
| top_k_df = df.nlargest(top_k, value) | |
| category_counts = top_k_df[category].value_counts() | |
| data = pd.DataFrame({category: category_counts.index, 'value': category_counts.values}) | |
| data['proportion'] = data['value'] / data['value'].sum() | |
| # Merge rows with proportion less than 0.2% into one row | |
| mask = data['proportion'] < 0.002 | |
| if any(mask): | |
| merged_row = data[mask].sum() | |
| merged_row[category] = '...' | |
| data = pd.concat([data[~mask], pd.DataFrame(merged_row).T]) | |
| data['angle'] = data['proportion'] * 2 * pi | |
| color_dict = {cat: color for cat, color in | |
| zip(df[category].unique(), | |
| (Category20c_20 * (len(df[category].unique()) // 20 + 1))[:len(df[category].unique())])} | |
| color_dict['...'] = '#636363' | |
| data['color'] = data[category].map(color_dict) | |
| tooltips = [ | |
| (f"{category}", f"@{{{category}}}"), | |
| ("Count", "@value"), | |
| ("Percentage", "@proportion{0.0%}") | |
| ] | |
| if category == 'Scaffold SMILES': | |
| data = data.merge(top_k_df[['Scaffold SMILES', 'Scaffold']].drop_duplicates(), how='left', | |
| left_on='Scaffold SMILES', right_on='Scaffold SMILES') | |
| tooltips.append(("Scaffold", "<div>@{Scaffold}{safe}</div>")) | |
| p = figure(height=384, width=960, name=f"Top {top_k}" if top_k < len(df) else 'All', sizing_mode='stretch_height', | |
| toolbar_location=None, tools="hover", tooltips=tooltips, x_range=(-0.4, 0.4)) | |
| def truncate_label(label, max_length=60): | |
| return label if len(label) <= max_length else label[:max_length] + "..." | |
| data['legend_field'] = data[category].apply(truncate_label) | |
| p.add_layout(Legend(padding=0, margin=0), 'right') | |
| p.wedge(x=0, y=1, radius=0.3, | |
| start_angle=cumsum('angle', include_zero=True), end_angle=cumsum('angle'), | |
| line_color="white", fill_color='color', legend_field='legend_field', source=data) | |
| # Limit the number of legend items to 20 and add "..." if there are more than 20 items | |
| if len(p.legend.items) > 20: | |
| new_legend_items = p.legend.items[:20] | |
| new_legend_items.append(LegendItem(label="...")) | |
| p.legend.items = new_legend_items | |
| p.legend.label_text_font_size = "10pt" | |
| p.legend.label_text_font = "courier" | |
| p.axis.axis_label = None | |
| p.axis.visible = False | |
| p.grid.grid_line_color = None | |
| p.outline_line_width = 0 | |
| p.min_border = 0 | |
| p.margin = 0 | |
| return p | |
| def submit_report(df, score_list, filter_list, task, progress=gr.Progress(track_tqdm=True)): | |
| df_report = df.copy() | |
| try: | |
| for filter_name in filter_list: | |
| df_report[filter_name] = df_report['Compound'].parallel_apply( | |
| lambda x: FILTER_MAP[filter_name](x) if not pd.isna(x) else x) | |
| for score_name in score_list: | |
| df_report[score_name] = df_report['Compound'].parallel_apply( | |
| lambda x: SCORE_MAP[score_name](x) if not pd.isna(x) else x) | |
| # pie_chart = None | |
| # value = None | |
| # if 'Y^' in df.columns: | |
| # value = 'Y^' | |
| # elif 'Y' in df.columns: | |
| # value = 'Y' | |
| # | |
| # if value: | |
| # if df['X1'].nunique() > 1 >= df['X2'].nunique(): | |
| # pie_chart = create_pie_chart(df, category='Scaffold SMILES', value=value, top_k=100) | |
| # elif df['X2'].nunique() > 1 >= df['X1'].nunique(): | |
| # pie_chart = create_pie_chart(df, category='Target family', value=value, top_k=100) | |
| return (create_html_report(df_report, file=None, task=task), df_report, | |
| gr.File(visible=False), gr.File(visible=False)) | |
| except Exception as e: | |
| gr.Warning(f'Failed to report results due to error: {str(e)}') | |
| return None, None, None, None | |
| def wrap_text(text, line_length=60): | |
| if isinstance(text, str): | |
| wrapper = textwrap.TextWrapper(width=line_length) | |
| if text.startswith('>'): | |
| sections = text.split('>') | |
| wrapped_sections = [] | |
| for section in sections: | |
| if not section: | |
| continue | |
| lines = section.split('\n') | |
| seq_header = lines[0] | |
| wrapped_seq = wrapper.fill(''.join(lines[1:])) | |
| wrapped_sections.append(f">{seq_header}\n{wrapped_seq}") | |
| return '\n'.join(wrapped_sections) | |
| else: | |
| return wrapper.fill(text) | |
| else: | |
| return text | |
| def unwrap_text(text): | |
| return text.strip.replece('\n', '') | |
| def drug_library_from_sdf(sdf_path): | |
| return PandasTools.LoadSDF( | |
| sdf_path, | |
| smilesName='X1', molColName='Compound', includeFingerprints=True | |
| ) | |
| def process_target_library_upload(library_upload): | |
| if library_upload.endswith('.csv'): | |
| df = pd.read_csv(library_upload) | |
| elif library_upload.endswith('.fasta'): | |
| df = target_library_from_fasta(library_upload) | |
| else: | |
| raise gr.Error('Currently only CSV and FASTA files are supported as target libraries.') | |
| validate_columns(df, ['X2']) | |
| return df | |
| def process_drug_library_upload(library_upload): | |
| if library_upload.endswith('.csv'): | |
| df = pd.read_csv(library_upload) | |
| elif library_upload.endswith('.sdf'): | |
| df = drug_library_from_sdf(library_upload) | |
| else: | |
| raise gr.Error('Currently only CSV and SDF files are supported as drug libraries.') | |
| validate_columns(df, ['X1']) | |
| return df | |
| def target_library_from_fasta(fasta_path): | |
| records = list(SeqIO.parse(fasta_path, "fasta")) | |
| id2 = [record.id for record in records] | |
| seq = [str(record.seq) for record in records] | |
| df = pd.DataFrame({'ID2': id2, 'X2': seq}) | |
| return df | |
| theme = gr.themes.Base(spacing_size="sm", text_size='md', font=gr.themes.GoogleFont("Roboto")).set( | |
| background_fill_primary='#eef3f9', | |
| background_fill_secondary='white', | |
| checkbox_label_background_fill='#eef3f9', | |
| checkbox_label_background_fill_hover='#dfe6f0', | |
| checkbox_background_color='white', | |
| checkbox_border_color='#4372c4', | |
| border_color_primary='#4372c4', | |
| border_color_accent='#2e6ab5', | |
| button_primary_background_fill='#2e6ab4', | |
| button_primary_text_color='white', | |
| body_text_color='#28496F', | |
| block_background_fill='#fbfcfd', | |
| block_title_text_color='#28496F', | |
| block_label_text_color='#28496F', | |
| block_info_text_color='#505358', | |
| block_border_color=None, | |
| # input_border_color='#4372c4', | |
| # panel_border_color='#4372c4', | |
| input_background_fill='#F1F2F4', | |
| ) | |
| with gr.Blocks(theme=theme, title='DeepSEQreen', css=CSS, delete_cache=(3600, 48 * 3600)) as demo: | |
| run_state = gr.State(value=False) | |
| screen_flag = gr.State(value=False) | |
| identify_flag = gr.State(value=False) | |
| infer_flag = gr.State(value=False) | |
| with gr.Tabs() as tabs: | |
| with gr.TabItem(label='Drug Hit Screening', id='Drug Hit Screening'): | |
| gr.Markdown(''' | |
| # <center>Drug Hit Screening</center> | |
| <center> | |
| To predict interactions or binding affinities of a single target against a compound library. | |
| </center> | |
| ''') | |
| with gr.Row(): | |
| with gr.Column(): | |
| HelpTip( | |
| "Enter (paste) a amino acid sequence below manually or upload a FASTA file. " | |
| "If multiple entities are in the FASTA, only the first will be used. " | |
| "Alternatively, enter a Uniprot ID or gene symbol with organism and click Query for " | |
| "the sequence." | |
| ) | |
| target_input_type = gr.Dropdown( | |
| label='Step 1. Select Target Input Type and Input', | |
| choices=['Sequence', 'UniProt ID', 'Gene symbol'], | |
| info='Enter (paste) a FASTA string below manually or upload a FASTA file.', | |
| value='Sequence', | |
| scale=4, interactive=True | |
| ) | |
| with gr.Row(): | |
| target_id = gr.Textbox(show_label=False, visible=False, | |
| interactive=True, scale=4, | |
| info='Enter a UniProt ID and query.') | |
| target_gene = gr.Textbox( | |
| show_label=False, visible=False, | |
| interactive=True, scale=4, | |
| info='Enter a gene symbol and query. The first record will be used.') | |
| target_organism = gr.Textbox( | |
| info='Organism scientific name (default: Homo sapiens).', | |
| placeholder='Homo sapiens', show_label=False, | |
| visible=False, interactive=True, scale=4, ) | |
| target_upload_btn = gr.UploadButton(label='Upload a FASTA File', type='binary', | |
| visible=True, variant='primary', | |
| size='lg') | |
| target_paste_markdown = gr.Button(value='OR Paste Your Sequence Below', | |
| variant='secondary') | |
| target_query_btn = gr.Button(value='Query the Sequence', variant='primary', | |
| visible=False, scale=4) | |
| # with gr.Row(): | |
| # example_uniprot = gr.Button(value='Example: Q16539', elem_classes='example', visible=False) | |
| # example_gene = gr.Button(value='Example: MAPK14', elem_classes='example', visible=False) | |
| example_fasta = gr.Button(value='Example: MAPK14 (Q16539)', elem_classes='example') | |
| target_fasta = gr.Code(label='Input or Display FASTA', interactive=True, lines=5) | |
| # with gr.Row(): | |
| # with gr.Column(): | |
| # with gr.Column(): | |
| # gr.File(label='Example FASTA file', | |
| # value='data/examples/MAPK14.fasta', interactive=False) | |
| with gr.Row(): | |
| with gr.Column(min_width=200): | |
| HelpTip( | |
| "Click Auto-detect to identify the protein family using sequence alignment. " | |
| "This optional step allows applying a family-specific model instead of a all-family " | |
| "model (general). " | |
| "Manually select general if the alignment results are unsatisfactory." | |
| ) | |
| drug_screen_target_family = gr.Dropdown( | |
| choices=list(TARGET_FAMILY_MAP.keys()), | |
| value='General', | |
| label='Step 2. Select Target Family (Optional)', interactive=True) | |
| target_family_detect_btn = gr.Button(value='OR Let Us Auto-Detect for You', | |
| variant='primary') | |
| with gr.Column(min_width=200): | |
| HelpTip( | |
| "Interaction prediction provides you binding probability score between the target of " | |
| "interest and each compound in the library, " | |
| "while affinity prediction directly estimates their binding strength measured using " | |
| "pIC<sub>50</sub> in units of nM." | |
| ) | |
| drug_screen_task = gr.Dropdown( | |
| list(TASK_MAP.keys()), | |
| label='Step 3. Select a Prediction Task', | |
| value='Compound-Protein Interaction') | |
| with gr.Column(min_width=200): | |
| HelpTip( | |
| "Select your preferred model, or click Recommend for the best-performing model based " | |
| "on the selected task, family, and whether the target was trained. " | |
| "Please refer to documentation for detailed benchmark results." | |
| ) | |
| drug_screen_preset = gr.Dropdown( | |
| list(PRESET_MAP.keys()), | |
| label='Step 4. Select a Preset Model') | |
| screen_preset_recommend_btn = gr.Button( | |
| value='OR Let Us Recommend for You', variant='primary') | |
| with gr.Row(): | |
| with gr.Column(): | |
| HelpTip( | |
| "Select a preset compound library (e.g., DrugBank). " | |
| "Alternatively, upload a CSV file with a column named X1 containing compound SMILES, " | |
| "or use an SDF file (Max. 10,000 compounds per task). Example CSV and SDF files are " | |
| "provided below and can be downloaded by clicking the lower right corner." | |
| ) | |
| drug_library = gr.Dropdown( | |
| label='Step 5. Select a Preset Compound Library', | |
| choices=list(DRUG_LIBRARY_MAP.keys())) | |
| with gr.Row(): | |
| gr.File(label='Example SDF compound library', | |
| value='data/examples/compound_library.sdf', interactive=False) | |
| gr.File(label='Example CSV compound library', | |
| value='data/examples/compound_library.csv', interactive=False) | |
| drug_library_upload_btn = gr.UploadButton( | |
| label='OR Upload Your Own Library', variant='primary') | |
| drug_library_upload = gr.File(label='Custom compound library file', visible=False) | |
| drug_screen_opts = gr.CheckboxGroup( | |
| ['Include Max. Tanimoto Similarity'], | |
| label='Step 6. Select Additional Options', | |
| info="Calculating the maximum Tanimoto similarity of the library compounds to the " | |
| "training dataset is an experimental feature and may take a considerable amount of time." | |
| ) | |
| with gr.Row(): | |
| with gr.Column(): | |
| drug_screen_email = gr.Textbox( | |
| label='Step 7. Input Your Email Address (Optional)', | |
| info="Your email address will be used to notify you of the status of your job. " | |
| "If you cannot receive the email, please check your spam/junk folder." | |
| ) | |
| with gr.Row(visible=True): | |
| with gr.Row(): | |
| drug_screen_clr_btn = gr.ClearButton(size='lg') | |
| drug_screen_btn = gr.Button(value='SUBMIT THE SCREENING JOB', variant='primary', size='lg') | |
| # TODO Modify the pd df directly with df['X2'] = target | |
| screen_data_for_predict = gr.File(visible=False, file_count="single", type='filepath') | |
| with gr.TabItem(label='Target Protein Identification', id='Target Protein Identification'): | |
| gr.Markdown(''' | |
| # <center>Target Protein Identification</center> | |
| <center> | |
| To predict interactions or binding affinities of a single compound against a protein library. | |
| </center> | |
| ''') | |
| with gr.Column() as identify_page: | |
| with gr.Row(): | |
| with gr.Column(): | |
| HelpTip( | |
| "Enter (paste) a compound SMILES below manually or upload a SDF file. " | |
| "If multiple entities are in the SDF, only the first will be used. " | |
| "SMILES can be obtained by searching for the compound of interest in databases such " | |
| "as NCBI, PubChem and and ChEMBL." | |
| ) | |
| compound_type = gr.Dropdown( | |
| label='Step 1. Select Compound Input Type and Input', | |
| choices=['SMILES', 'SDF'], | |
| info='Enter (paste) an SMILES string or upload an SDF file to convert to SMILES.', | |
| value='SMILES', | |
| interactive=True) | |
| compound_upload_btn = gr.UploadButton( | |
| label='OR Upload a SDF File', variant='primary', type='binary', visible=False) | |
| compound_smiles = gr.Code(label='Input or Display Compound SMILES', interactive=True, lines=5) | |
| example_drug = gr.Button(value='Example: Aspirin', elem_classes='example') | |
| with gr.Row(): | |
| with gr.Column(visible=True): | |
| HelpTip( | |
| "By default, models trained on all protein families (general) will be applied. " | |
| "If you upload a target library containing proteins all in the same family, " | |
| "you may manually select a Target Family." | |
| ) | |
| target_identify_target_family = gr.Dropdown( | |
| choices=['Family-Specific Auto-Recommendation'] + list(TARGET_FAMILY_MAP.keys()), | |
| value='General', | |
| label='Step 2. Select Target Family') | |
| with gr.Column(): | |
| HelpTip( | |
| "Interaction prediction provides you binding probability score between the target of " | |
| "interest and each compound in the library, while affinity prediction directly " | |
| "estimates their binding strength measured using pIC<sub>50</sub> in units of nM." | |
| ) | |
| target_identify_task = gr.Dropdown( | |
| list(TASK_MAP.keys()), | |
| label='Step 3. Select a Prediction Task', | |
| value='Compound-Protein Interaction') | |
| with gr.Column(): | |
| HelpTip( | |
| "Select your preferred model, or click Recommend for the best-performing model based " | |
| "on the selected task and whether the compound was trained. By default, General-trained " | |
| "model is used for Target Protein Identification. " | |
| "Please refer to the documentation for detailed benchmark results." | |
| ) | |
| target_identify_preset = gr.Dropdown( | |
| ['Family-Specific Auto-Recommendation'] + list(PRESET_MAP.keys()), | |
| label='Step 4. Select a Preset Model') | |
| identify_preset_recommend_btn = gr.Button(value='OR Let Us Recommend for You', | |
| variant='primary') | |
| with gr.Row(): | |
| with gr.Column(): | |
| HelpTip( | |
| "Select a preset target library (e.g., ChEMBL33_human_proteins). " | |
| "Alternatively, upload a CSV file with a column named X2 containing target protein " | |
| "sequences, or use an FASTA file (Max. 10,000 targets per task). " | |
| "Example CSV and SDF files are provided below " | |
| "and can be downloaded by clicking the lower right corner." | |
| ) | |
| target_library = gr.Dropdown( | |
| label='Step 5. Select a Preset Target Library', | |
| choices=list(TARGET_LIBRARY_MAP.keys())) | |
| with gr.Row(): | |
| gr.File(label='Example FASTA target library', | |
| value='data/examples/target_library.fasta', interactive=False) | |
| gr.File(label='Example CSV target library', | |
| value='data/examples/target_library.csv', interactive=False) | |
| target_library_upload_btn = gr.UploadButton( | |
| label='OR Upload Your Own Library', variant='primary') | |
| target_library_upload = gr.File(label='Custom target library file', visible=False) | |
| target_identify_opts = gr.CheckboxGroup( | |
| ['Include Max. Sequence Identity'], | |
| label='Step 6. Select Additional Options', | |
| info="Calculating the maximum sequence identity of the library protein to the " | |
| "training dataset is an experimental feature and may take a considerable amount of time." | |
| ) | |
| with gr.Row(): | |
| with gr.Column(): | |
| target_identify_email = gr.Textbox( | |
| label='Step 7. Input Your Email Address (Optional)', | |
| info="Your email address will be used to notify you of the status of your job. " | |
| "If you cannot receive the email, please check your spam/junk folder." | |
| ) | |
| with gr.Row(visible=True): | |
| target_identify_clr_btn = gr.ClearButton(size='lg') | |
| target_identify_btn = gr.Button(value='SUBMIT THE IDENTIFICATION JOB', variant='primary', | |
| size='lg') | |
| identify_data_for_predict = gr.File(visible=False, file_count="single", type='filepath') | |
| with gr.TabItem(label='Interaction Pair Inference', id='Interaction Pair Inference'): | |
| gr.Markdown(''' | |
| # <center>Interaction Pair Inference</center> | |
| <center>To predict interactions or binding affinities between up to | |
| 10,000 paired compound-protein data.</center> | |
| ''') | |
| HelpTip( | |
| "A custom interation pair dataset can be a CSV file with 2 required columns " | |
| "(X1 for smiles and X2 for sequences) " | |
| "and optionally 2 ID columns (ID1 for compound ID and ID2 for target ID), " | |
| "or generated from a FASTA file containing multiple " | |
| "sequences and a SDF file containing multiple compounds. " | |
| "Currently, a maximum of 10,000 pairs is supported, " | |
| "which means that the size of CSV file or " | |
| "the product of the two library sizes should not exceed 10,000." | |
| ) | |
| infer_type = gr.Dropdown( | |
| choices=['Upload a CSV file containing paired compound-protein data', | |
| 'Upload a compound library and a target library'], | |
| label='Step 1. Select Pair Input Type and Input', | |
| value='Upload a CSV file containing paired compound-protein data') | |
| with gr.Column() as pair_upload: | |
| gr.File(label="Example CSV dataset", | |
| value="data/examples/interaction_pair_inference.csv", | |
| interactive=False) | |
| with gr.Row(): | |
| infer_csv_prompt = gr.Button( | |
| value="Upload Your Own Dataset Below", | |
| variant='secondary') | |
| with gr.Column(): | |
| infer_pair = gr.File( | |
| label='Upload CSV File Containing Paired Records', | |
| file_count="single", type='filepath', visible=True) | |
| with gr.Column(visible=False) as pair_generate: | |
| with gr.Row(): | |
| gr.File(label='Example SDF compound library', | |
| value='data/examples/compound_library.sdf', interactive=False) | |
| gr.File(label='Example FASTA target library', | |
| value='data/examples/target_library.fasta', interactive=False) | |
| with gr.Row(): | |
| gr.File(label='Example CSV compound library', | |
| value='data/examples/compound_library.csv', interactive=False) | |
| gr.File(label='Example CSV target library', | |
| value='data/examples/target_library.csv', interactive=False) | |
| with gr.Row(): | |
| infer_library_prompt = gr.Button( | |
| value="Upload Your Own Libraries Below", | |
| visible=False, variant='secondary') | |
| with gr.Row(): | |
| infer_drug = gr.File(label='Upload SDF/CSV File Containing Multiple Compounds', | |
| file_count="single", type='filepath') | |
| infer_target = gr.File(label='Upload FASTA/CSV File Containing Multiple Targets', | |
| file_count="single", type='filepath') | |
| with gr.Row(): | |
| with gr.Column(min_width=200): | |
| HelpTip( | |
| "By default, models trained on all protein families (general) will be applied. " | |
| "If the proteins in the target library of interest " | |
| "all belong to the same protein family, manually selecting the family is supported." | |
| ) | |
| pair_infer_target_family = gr.Dropdown( | |
| choices=list(TARGET_FAMILY_MAP.keys()), | |
| value='General', | |
| label='Step 2. Select Target Family (Optional)') | |
| with gr.Column(min_width=200): | |
| HelpTip( | |
| "Interaction prediction provides you binding probability score " | |
| "between the target of interest and each compound in the library, " | |
| "while affinity prediction directly estimates their binding strength " | |
| "measured using pIC<sub>50</sub> in units of nM." | |
| ) | |
| pair_infer_task = gr.Dropdown( | |
| list(TASK_MAP.keys()), | |
| label='Step 3. Select a Prediction Task', | |
| value='Compound-Protein Interaction') | |
| with gr.Column(min_width=200): | |
| HelpTip("Select your preferred model. " | |
| "Please refer to documentation for detailed benchmark results." | |
| ) | |
| pair_infer_preset = gr.Dropdown( | |
| list(PRESET_MAP.keys()), | |
| label='Step 4. Select a Preset Model') | |
| # infer_preset_recommend_btn = gr.Button(value='OR Let Us Recommend for You', | |
| # variant='primary') | |
| pair_infer_opts = gr.CheckboxGroup(visible=False) | |
| with gr.Row(): | |
| pair_infer_email = gr.Textbox( | |
| label='Step 5. Input Your Email Address (Optional)', | |
| info="Your email address will be used to notify you of the status of your job. " | |
| "If you cannot receive the email, please check your spam/junk folder.") | |
| with gr.Row(visible=True): | |
| pair_infer_clr_btn = gr.ClearButton(size='lg') | |
| pair_infer_btn = gr.Button(value='SUBMIT THE INFERENCE JOB', variant='primary', size='lg') | |
| infer_data_for_predict = gr.File(file_count="single", type='filepath', visible=False) | |
| with gr.TabItem(label='Chemical Property Report', id='Chemical Property Report'): | |
| gr.Markdown(''' | |
| # <center>Chemical Property Report</center> | |
| To compute chemical properties for the predictions of Drug Hit Screening, | |
| Target Protein Identification, and Interaction Pair Inference. | |
| You may also upload your own dataset using a CSV file containing | |
| one required column `X1` for compound SMILES. | |
| The page shows only a preview report displaying at most 30 records | |
| (with top predicted CPI/CPA if reporting results from a prediction job). | |
| Please first `Preview` the report, then `Generate` and download a CSV report | |
| or an interactive HTML report below if you wish to access the full report. | |
| ''') | |
| raw_df = gr.State(value=pd.DataFrame()) | |
| report_df = gr.State(value=pd.DataFrame()) | |
| with gr.Row(): | |
| with gr.Column(scale=1): | |
| file_for_report = gr.File(interactive=True, type='filepath') | |
| report_task = gr.Dropdown(list(TASK_MAP.keys()), visible=False, | |
| value='Compound-Protein Interaction', | |
| label='Specify the Task Labels in the Uploaded Dataset') | |
| with gr.Column(scale=2): | |
| with gr.Row(): | |
| scores = gr.CheckboxGroup(list(SCORE_MAP.keys()), label='Compound Scores') | |
| filters = gr.CheckboxGroup(list(FILTER_MAP.keys()), label='Compound Filters') | |
| with gr.Accordion('Report Generate Options', open=False): | |
| with gr.Row(): | |
| csv_sep = gr.Radio(label='CSV Delimiter', | |
| choices=['Comma', 'Tab'], value='Comma') | |
| html_opts = gr.CheckboxGroup(label='HTML Report Options', | |
| choices=['Exclude Molecular Graph', 'Exclude Scaffold Graph']) | |
| with gr.Row(): | |
| report_clr_btn = gr.ClearButton(size='lg') | |
| analyze_btn = gr.Button('Calculate Properties and Preview', variant='primary', | |
| size='lg', interactive=False) | |
| with gr.Row(): | |
| with gr.Column(scale=3): | |
| html_report = gr.HTML() # label='Results', visible=True) | |
| ranking_pie_chart = gr.Plot(visible=False) | |
| with gr.Row(): | |
| with gr.Column(): | |
| csv_generate = gr.Button(value='Generate CSV Report', | |
| interactive=False, variant='primary') | |
| csv_download_file = gr.File(label='Download CSV Report', visible=False) | |
| with gr.Column(): | |
| html_generate = gr.Button(value='Generate HTML Report', | |
| interactive=False, variant='primary') | |
| html_download_file = gr.File(label='Download HTML Report', visible=False) | |
| with gr.TabItem(label='Prediction Status Lookup', id='Prediction Status Lookup'): | |
| gr.Markdown(''' | |
| # <center>Prediction Status Lookup</center> | |
| To check the status of an in-progress or historical job using the job ID and retrieve the predictions | |
| if the job has completed. Note that predictions are only kept for 48 hours upon job completion. | |
| You will be redirected to Chemical Property Report for carrying out further analysis and | |
| generating the full report when the job is done. If the Lookup fails to respond, please wait for a | |
| few minutes and refresh the page to try again. | |
| ''') | |
| with gr.Column(): | |
| pred_lookup_id = gr.Textbox( | |
| label='Input Your Job ID', placeholder='e.g., e9dfd149-3f5c-48a6-b797-c27d027611ac', | |
| info="Your job ID is a UUID4 string that you receive after submitting a job on the " | |
| "page or in the email notification.") | |
| pred_lookup_btn = gr.Button(value='Lookup the Job Status', variant='primary', visible=True) | |
| pred_lookup_stop_btn = gr.Button(value='Stop Tracking', variant='stop', visible=False) | |
| pred_lookup_status = gr.Markdown() | |
| # retrieve_email = gr.Textbox(label='Step 2. Input Your Email Address', placeholder='e.g., | |
| def target_input_type_select(input_type): | |
| match input_type: | |
| case 'UniProt ID': | |
| return [gr.Dropdown(info=''), | |
| gr.UploadButton(visible=False), | |
| gr.Textbox(visible=True, value=''), | |
| gr.Textbox(visible=False, value=''), | |
| gr.Textbox(visible=False, value=''), | |
| gr.Button(visible=True), | |
| gr.Code(value=''), | |
| gr.Button(visible=False)] | |
| case 'Gene symbol': | |
| return [gr.Dropdown(info=''), | |
| gr.UploadButton(visible=False), | |
| gr.Textbox(visible=False, value=''), | |
| gr.Textbox(visible=True, value=''), | |
| gr.Textbox(visible=True, value=''), | |
| gr.Button(visible=True), | |
| gr.Code(value=''), | |
| gr.Button(visible=False)] | |
| case 'Sequence': | |
| return [gr.Dropdown(info='Enter (paste) a FASTA string below manually or upload a FASTA file.'), | |
| gr.UploadButton(visible=True), | |
| gr.Textbox(visible=False, value=''), | |
| gr.Textbox(visible=False, value=''), | |
| gr.Textbox(visible=False, value=''), | |
| gr.Button(visible=False), | |
| gr.Code(value=''), | |
| gr.Button(visible=True)] | |
| target_input_type.select( | |
| fn=target_input_type_select, | |
| inputs=target_input_type, | |
| outputs=[ | |
| target_input_type, target_upload_btn, | |
| target_id, target_gene, target_organism, target_query_btn, | |
| target_fasta, target_paste_markdown | |
| ], | |
| show_progress='hidden' | |
| ) | |
| def uniprot_query(input_type, uid, gene, organism='Human'): | |
| uniprot_endpoint = 'https://rest.uniprot.org/uniprotkb/{query}' | |
| fasta_rec = '' | |
| match input_type: | |
| case 'UniProt ID': | |
| query = f"{uid.strip()}.fasta" | |
| case 'Gene symbol': | |
| organism = organism if organism else 'Human' | |
| query = f'search?query=organism_name:{organism.strip()}+AND+gene:{gene.strip()}&format=fasta' | |
| try: | |
| fasta = session.get(uniprot_endpoint.format(query=query)) | |
| fasta.raise_for_status() | |
| if fasta.text: | |
| fasta_rec = next(SeqIO.parse(io.StringIO(fasta.text), format='fasta')) | |
| fasta_rec = f">{fasta_rec.description}\n{fasta_rec.seq}" | |
| except Exception as e: | |
| raise gr.Warning(f"Failed to query FASTA from UniProt database due to {str(e)}") | |
| finally: | |
| return fasta_rec | |
| def process_fasta_upload(fasta_upload): | |
| fasta = '' | |
| try: | |
| fasta = fasta_upload.decode() | |
| except Exception as e: | |
| gr.Warning(f"Please upload a valid FASTA file. Error: {str(e)}") | |
| return fasta | |
| target_upload_btn.upload( | |
| fn=process_fasta_upload, inputs=target_upload_btn, outputs=target_fasta | |
| ).then( | |
| fn=wrap_text, inputs=target_fasta, outputs=target_fasta, show_progress='hidden' | |
| ) | |
| target_query_btn.click( | |
| fn=uniprot_query, inputs=[target_input_type, target_id, target_gene, target_organism], outputs=target_fasta | |
| ).then( | |
| fn=wrap_text, inputs=target_fasta, outputs=target_fasta, show_progress='hidden' | |
| ) | |
| def target_family_detect(fasta, progress=gr.Progress(track_tqdm=True)): | |
| try: | |
| aligner = PairwiseAligner(mode='local') | |
| alignment_df = get_fasta_family_map() | |
| processed_fasta = process_target_fasta(fasta) | |
| # Check for an exact match first | |
| exact_match = alignment_df[alignment_df['X2'] == processed_fasta] | |
| if not exact_match.empty: | |
| row = exact_match.iloc[0] | |
| family = str(row['Target Family']).title() | |
| return gr.Dropdown( | |
| value=family, | |
| info=f"Reason: Exact match found with {row['ID2']} from family {family}") | |
| # If no exact match, then calculate alignment score | |
| def align_score(query): | |
| alignment = aligner.align(processed_fasta, query) | |
| return alignment.score / max(len(processed_fasta), len(query)) | |
| alignment_df['score'] = alignment_df['X2'].parallel_apply(align_score) | |
| row = alignment_df.loc[alignment_df['score'].idxmax()] | |
| family = str(row['Target Family']).title() | |
| return gr.Dropdown(value=family, | |
| info=f"Reason: Best sequence identity ({row['score']}) " | |
| f"with {row['ID2']} from family {family}") | |
| except Exception as e: | |
| gr.Warning("Failed to detect the protein family due to error: " + str(e)) | |
| target_family_detect_btn.click(fn=target_family_detect, inputs=target_fasta, outputs=drug_screen_target_family) | |
| # target_fasta.focus(fn=wrap_text, inputs=target_fasta, outputs=target_fasta, show_progress='hidden') | |
| target_fasta.blur(fn=wrap_text, inputs=target_fasta, outputs=target_fasta, show_progress='hidden') | |
| drug_library_upload_btn.upload(fn=lambda x: [ | |
| x.name, gr.Dropdown(value=Path(x.name).name, choices=list(DRUG_LIBRARY_MAP.keys()) + [Path(x.name).name]) | |
| ], inputs=drug_library_upload_btn, outputs=[drug_library_upload, drug_library]) | |
| def example_fill(input_type): | |
| return {target_id: 'Q16539', | |
| target_gene: 'MAPK14', | |
| target_organism: 'Human', | |
| target_fasta: """ | |
| >sp|Q16539|MK14_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens OX=9606 GN=MAPK14 PE=1 SV=3 | |
| MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ | |
| SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ | |
| KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT | |
| GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG | |
| TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA | |
| QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES | |
| """} | |
| example_fasta.click(fn=example_fill, inputs=target_input_type, outputs=[ | |
| target_id, target_gene, target_organism, target_fasta], show_progress='hidden') | |
| def screen_recommend_model(fasta, family, task): | |
| task = TASK_MAP[task] | |
| score = TASK_METRIC_MAP[task] | |
| benchmark_df = pd.read_csv(f'data/benchmarks/{task}_test_metrics.csv') | |
| if not fasta: | |
| gr.Warning('Please enter a valid FASTA for model recommendation.') | |
| return [None, family] | |
| if family == 'General': | |
| seen_targets = pd.read_csv( | |
| f'data/benchmarks/seen_targets/all_families_full_{task.lower()}_random_split.csv') | |
| if process_target_fasta(fasta) in seen_targets['X2'].values: | |
| scenario = "Seen Target" | |
| else: | |
| scenario = "Unseen Target" | |
| filtered_df = benchmark_df[(benchmark_df['Family'] == 'All Families') | |
| & (benchmark_df['Scenario'] == scenario) | |
| & (benchmark_df['Type'] == 'General')] | |
| else: | |
| seen_targets_general = pd.read_csv( | |
| f'data/benchmarks/seen_targets/all_families_full_{task.lower()}_random_split.csv') | |
| if process_target_fasta(fasta) in seen_targets_general['X2'].values: | |
| scenario_general = "Seen Target" | |
| else: | |
| scenario_general = "Unseen Target" | |
| seen_targets_family = pd.read_csv( | |
| f'data/benchmarks/seen_targets/{TARGET_FAMILY_MAP[family.title()]}_{task.lower()}_random_split.csv') | |
| if process_target_fasta(fasta) in seen_targets_family['X2'].values: | |
| scenario_family = "Seen Target" | |
| else: | |
| scenario_family = "Unseen Target" | |
| filtered_df_general = benchmark_df[(benchmark_df['Family'] == family) | |
| & (benchmark_df['Scenario'] == scenario_general) | |
| & (benchmark_df['Type'] == 'General')] | |
| filtered_df_family = benchmark_df[(benchmark_df['Family'] == family) | |
| & (benchmark_df['Scenario'] == scenario_family) | |
| & (benchmark_df['Type'] == 'Family')] | |
| filtered_df = pd.concat([filtered_df_general, filtered_df_family]) | |
| row = filtered_df.loc[filtered_df[score].idxmax()] | |
| if row['Scenario'] == 'Seen Target': | |
| scenario = "Seen Target (>=0.85 sequence identity)" | |
| elif row['Scenario'] == 'Unseen Target': | |
| scenario = "Unseen Target (<0.85 sequence identity)" | |
| return {drug_screen_preset: | |
| gr.Dropdown(value=row['Model'], | |
| info=f"Reason: {row['Scenario']} in training; we recommend the {row['Type']}-trained " | |
| f"model with the best {score} in the {scenario} scenario " | |
| f"on {row['Family']}."), | |
| drug_screen_target_family: | |
| gr.Dropdown(value='General') if row['Type'] == 'General' else gr.Dropdown(value=family)} | |
| screen_preset_recommend_btn.click(fn=screen_recommend_model, | |
| inputs=[target_fasta, drug_screen_target_family, drug_screen_task], | |
| outputs=[drug_screen_preset, drug_screen_target_family], show_progress='hidden') | |
| def compound_input_type_select(input_type): | |
| match input_type: | |
| case 'SMILES': | |
| return gr.Button(visible=False) | |
| case 'SDF': | |
| return gr.Button(visible=True) | |
| compound_type.select(fn=compound_input_type_select, | |
| inputs=compound_type, outputs=compound_upload_btn, show_progress='hidden') | |
| def compound_upload_process(input_type, input_upload): | |
| smiles = '' | |
| try: | |
| match input_type: | |
| case 'SMILES': | |
| smiles = input_upload.decode() | |
| case 'SDF': | |
| suppl = Chem.ForwardSDMolSupplier(io.BytesIO(input_upload)) | |
| smiles = Chem.MolToSmiles(next(suppl)) | |
| except Exception as e: | |
| gr.Warning(f"Please upload a valid {input_type} file. Error: {str(e)}") | |
| return smiles | |
| compound_upload_btn.upload(fn=compound_upload_process, | |
| inputs=[compound_type, compound_upload_btn], | |
| outputs=compound_smiles) | |
| example_drug.click(fn=lambda: 'CC(=O)Oc1ccccc1C(=O)O', outputs=compound_smiles, show_progress='hidden') | |
| target_library_upload_btn.upload(fn=lambda x: [ | |
| x.name, gr.Dropdown(value=Path(x.name).name, choices=list(TARGET_LIBRARY_MAP.keys()) + [Path(x.name).name]) | |
| ], inputs=target_library_upload_btn, outputs=[target_library_upload, target_library]) | |
| def identify_recommend_model(smiles, family, task): | |
| task = TASK_MAP[task] | |
| score = TASK_METRIC_MAP[task] | |
| benchmark_df = pd.read_csv(f'data/benchmarks/{task}_test_metrics.csv') | |
| if not smiles: | |
| gr.Warning('Please enter a valid SMILES for model recommendation.') | |
| return None | |
| if family == 'Family-Specific Auto-Recommendation': | |
| return None | |
| if family == 'General': | |
| seen_compounds = pd.read_csv( | |
| f'data/benchmarks/seen_compounds/all_families_full_{task.lower()}_random_split.csv') | |
| family = 'All Families' | |
| else: | |
| seen_compounds = pd.read_csv( | |
| f'data/benchmarks/seen_compounds/{TARGET_FAMILY_MAP[family.title()]}_{task.lower()}_random_split.csv') | |
| if rdkit_canonicalize(smiles) in seen_compounds['X1'].values: | |
| scenario = "Seen Compound" | |
| else: | |
| scenario = "Unseen Compound" | |
| filtered_df = benchmark_df[(benchmark_df['Family'] == family) | |
| & (benchmark_df['Scenario'] == scenario) | |
| & (benchmark_df['Type'] == 'General')] | |
| row = filtered_df.loc[filtered_df[score].idxmax()] | |
| return gr.Dropdown(value=row['Model'], | |
| info=f"Reason: {scenario} in training; choosing the model " | |
| f"with the best {score} in the {scenario} scenario.") | |
| identify_preset_recommend_btn.click(fn=identify_recommend_model, | |
| inputs=[compound_smiles, target_identify_target_family, target_identify_task], | |
| outputs=target_identify_preset, show_progress='hidden') | |
| def infer_type_change(upload_type): | |
| match upload_type: | |
| case "Upload a compound library and a target library": | |
| return { | |
| pair_upload: gr.Column(visible=False), | |
| pair_generate: gr.Column(visible=True), | |
| infer_pair: None, | |
| infer_drug: None, | |
| infer_target: None, | |
| infer_csv_prompt: gr.Button(visible=False), | |
| infer_library_prompt: gr.Button(visible=True), | |
| } | |
| match upload_type: | |
| case "Upload a CSV file containing paired compound-protein data": | |
| return { | |
| pair_upload: gr.Column(visible=True), | |
| pair_generate: gr.Column(visible=False), | |
| infer_pair: None, | |
| infer_drug: None, | |
| infer_target: None, | |
| infer_csv_prompt: gr.Button(visible=True), | |
| infer_library_prompt: gr.Button(visible=False), | |
| } | |
| infer_type.select(fn=infer_type_change, inputs=infer_type, | |
| outputs=[pair_upload, pair_generate, infer_pair, infer_drug, infer_target, | |
| infer_csv_prompt, infer_library_prompt], | |
| show_progress='hidden') | |
| def common_input_validate(state, preset, email, request): | |
| gr.Info('Start processing inputs...') | |
| if not preset: | |
| raise gr.Error('Please select a model.') | |
| if email: | |
| try: | |
| email_info = validate_email(email, check_deliverability=False) | |
| email = email_info.normalized | |
| except EmailNotValidError as e: | |
| raise gr.Error(f"Invalid email address: {str(e)}.") | |
| if state: | |
| raise gr.Error(f"You already have a running prediction job (ID: {state['id']}) under this session. " | |
| "Please wait for it to complete before submitting another job.") | |
| if check := check_user_running_job(email, request): | |
| raise gr.Error(check) | |
| return state, preset, email | |
| def common_job_initiate(job_id, job_type, email, request, task): | |
| gr.Info('Finished processing inputs. Initiating the prediction job... ' | |
| 'You will be redirected to Prediction Status Lookup after the job is submitted.') | |
| job_info = {'id': job_id, | |
| 'type': job_type, | |
| 'task': task, | |
| 'status': 'RUNNING', | |
| 'email': email, | |
| 'ip': request.headers.get('x-forwarded-for', request.client.host), | |
| 'cookies': dict(request.cookies), | |
| 'start_time': time(), | |
| 'end_time': None, | |
| 'expiry_time': None, | |
| 'error': None} | |
| db.insert(job_info) | |
| return job_info | |
| def drug_screen_validate(fasta, library, library_upload, preset, task, email, state, | |
| request: gr.Request, progress=gr.Progress(track_tqdm=True)): | |
| state, preset, email = common_input_validate(state, preset, email, request) | |
| fasta = process_target_fasta(fasta) | |
| err = validate_seq_str(fasta, FASTA_PAT) | |
| if err: | |
| raise gr.Error(f'Found error(s) in your Target FASTA input: {err}') | |
| if not library: | |
| raise gr.Error('Please select or upload a compound library.') | |
| if library in DRUG_LIBRARY_MAP.keys(): | |
| screen_df = pd.read_csv(Path('data/drug_libraries', DRUG_LIBRARY_MAP[library])) | |
| else: | |
| screen_df = process_drug_library_upload(library_upload) | |
| if len(screen_df) >= DATASET_MAX_LEN: | |
| raise gr.Error(f'The uploaded compound library has more records ' | |
| f'than the allowed maximum {DATASET_MAX_LEN}.') | |
| screen_df['X2'] = fasta | |
| job_id = str(uuid4()) | |
| temp_file = Path(f'{SERVER_DATA_DIR}/{job_id}_input.csv').resolve() | |
| screen_df.to_csv(temp_file, index=False, na_rep='') | |
| if temp_file.is_file(): | |
| job_info = common_job_initiate(job_id, 'Drug Hit Screening', email, request, task) | |
| return {screen_data_for_predict: str(temp_file), | |
| run_state: job_info} | |
| else: | |
| raise gr.Error('System failed to create temporary files. Please try again later.') | |
| def target_identify_validate(smiles, library, library_upload, preset, task, email, state, | |
| request: gr.Request, progress=gr.Progress(track_tqdm=True)): | |
| state, preset, email = common_input_validate(state, preset, email, request) | |
| smiles = smiles.strip() | |
| err = validate_seq_str(smiles, SMILES_PAT) | |
| if err: | |
| raise gr.Error(f'Found error(s) in your Compound SMILES input: {err}') | |
| if not library: | |
| raise gr.Error('Please select or upload a target library.') | |
| if library in TARGET_LIBRARY_MAP.keys(): | |
| identify_df = pd.read_csv(Path('data/target_libraries', TARGET_LIBRARY_MAP[library])) | |
| else: | |
| identify_df = process_target_library_upload(library_upload) | |
| if len(identify_df) >= DATASET_MAX_LEN: | |
| raise gr.Error(f'The uploaded target library has more records ' | |
| f'than the allowed maximum {DATASET_MAX_LEN}.') | |
| identify_df['X1'] = smiles | |
| job_id = str(uuid4()) | |
| temp_file = Path(f'{SERVER_DATA_DIR}/{job_id}_input.csv').resolve() | |
| identify_df.to_csv(temp_file, index=False, na_rep='') | |
| if temp_file.is_file(): | |
| job_info = common_job_initiate(job_id, 'Target Protein Identification', email, request, task) | |
| return {identify_data_for_predict: str(temp_file), | |
| run_state: job_info} | |
| else: | |
| raise gr.Error('System failed to create temporary files. Please try again later.') | |
| def pair_infer_validate(drug_target_pair_upload, drug_upload, target_upload, preset, task, email, state, | |
| request: gr.Request, progress=gr.Progress(track_tqdm=True)): | |
| state, preset, email = common_input_validate(state, preset, email, request) | |
| job_id = str(uuid4()) | |
| if drug_target_pair_upload: | |
| infer_df = pd.read_csv(drug_target_pair_upload) | |
| validate_columns(infer_df, ['X1', 'X2']) | |
| infer_df['X1_ERR'] = infer_df['X1'].parallel_apply( | |
| validate_seq_str, regex=SMILES_PAT) | |
| if not infer_df['X1_ERR'].isna().all(): | |
| raise ValueError( | |
| f"Encountered invalid SMILES:\n{infer_df[~infer_df['X1_ERR'].isna()][['X1', 'X1_ERR']]}") | |
| infer_df['X2_ERR'] = infer_df['X2'].parallel_apply( | |
| validate_seq_str, regex=FASTA_PAT) | |
| if not infer_df['X2_ERR'].isna().all(): | |
| raise ValueError( | |
| f"Encountered invalid FASTA:\n{infer_df[~infer_df['X2_ERR'].isna()][['X2', 'X2_ERR']]}") | |
| temp_file = Path(drug_target_pair_upload).resolve() | |
| elif drug_upload and target_upload: | |
| drug_df = process_drug_library_upload(drug_upload) | |
| target_df = process_target_library_upload(target_upload) | |
| drug_df.drop_duplicates(subset=['X1'], inplace=True) | |
| target_df.drop_duplicates(subset=['X2'], inplace=True) | |
| infer_df = pd.DataFrame(list(itertools.product(drug_df['X1'], target_df['X2'])), | |
| columns=['X1', 'X2']) | |
| infer_df = infer_df.merge(drug_df, on='X1').merge(target_df, on='X2') | |
| if len(infer_df) >= DATASET_MAX_LEN: | |
| raise gr.Error(f'The uploaded/generated compound-protein pair dataset has more records ' | |
| f'than the allowed maximum {DATASET_MAX_LEN}.') | |
| temp_file = Path(f'{SERVER_DATA_DIR}/{job_id}_input.csv').resolve() | |
| infer_df.to_csv(temp_file, index=False, na_rep='') | |
| else: | |
| raise gr.Error('Should upload a compound-protein pair dataset, or ' | |
| 'upload both a compound library and a target library.') | |
| if temp_file.is_file(): | |
| job_info = common_job_initiate(job_id, 'Interaction Pair Inference', email, request, task) | |
| return {infer_data_for_predict: str(temp_file), | |
| run_state: job_info} | |
| else: | |
| raise gr.Error('System failed to create temporary files. Please try again later.') | |
| def fill_job_id(job_info): | |
| try: | |
| return job_info['id'] | |
| except Exception as e: | |
| gr.Warning(f'Failed to fetch job ID due to error: {str(e)}') | |
| return '' | |
| drug_screen_click = drug_screen_btn.click( | |
| fn=drug_screen_validate, | |
| inputs=[target_fasta, drug_library, drug_library_upload, drug_screen_preset, drug_screen_task, | |
| drug_screen_email, run_state], | |
| outputs=[screen_data_for_predict, run_state], | |
| concurrency_limit=2, | |
| ) | |
| drug_screen_lookup = drug_screen_click.success( | |
| fn=lambda: gr.Tabs(selected='Prediction Status Lookup'), outputs=[tabs], | |
| ).then( | |
| fn=fill_job_id, inputs=[run_state], outputs=[pred_lookup_id] | |
| ).then( | |
| fn=lookup_job, | |
| inputs=[pred_lookup_id], | |
| outputs=[pred_lookup_status, pred_lookup_btn, pred_lookup_stop_btn, tabs, file_for_report], | |
| show_progress='minimal', | |
| concurrency_limit=100, | |
| ) | |
| drug_screen_click.success( | |
| fn=send_email, | |
| inputs=[run_state] | |
| ) | |
| drug_screen_click.success( | |
| fn=submit_predict, | |
| inputs=[screen_data_for_predict, drug_screen_task, drug_screen_preset, | |
| drug_screen_target_family, drug_screen_opts, run_state, ], | |
| outputs=[run_state, ] | |
| ) | |
| drug_screen_clr_btn.click( | |
| lambda: ['General'] + [[]] + [None] * 5, | |
| outputs=[drug_screen_target_family, drug_screen_opts, | |
| target_fasta, drug_screen_preset, drug_library, drug_library_upload, drug_screen_email], | |
| show_progress='hidden' | |
| ) | |
| target_identify_clr_btn.click( | |
| lambda: ['General'] + [[]] + [None] * 5, | |
| outputs=[target_identify_target_family, target_identify_opts, | |
| compound_smiles, target_identify_preset, target_library, target_library_upload, target_identify_email], | |
| show_progress='hidden' | |
| ) | |
| pair_infer_clr_btn.click( | |
| lambda: ['General'] + [None] * 5, | |
| outputs=[pair_infer_target_family, | |
| infer_pair, infer_drug, infer_target, pair_infer_preset, pair_infer_email], | |
| show_progress='hidden' | |
| ) | |
| report_clr_btn.click( | |
| lambda: [[]] * 3 + [None] * 5 + | |
| [gr.Button(interactive=False)] * 3 + | |
| [gr.File(visible=False, value=None)] * 2 + | |
| [gr.Dropdown(visible=False, value=None), ''], | |
| outputs=[ | |
| scores, filters, html_opts, | |
| file_for_report, raw_df, report_df, | |
| csv_generate, html_generate, analyze_btn, csv_download_file, html_download_file, report_task, html_report | |
| ], | |
| show_progress='hidden' | |
| ) | |
| def update_preset(family, preset): | |
| if family == 'Family-Specific Auto-Recommendation': | |
| return 'Family-Specific Auto-Recommendation' | |
| elif preset == 'Family-Specific Auto-Recommendation': | |
| return None | |
| else: | |
| return preset | |
| def update_family(family, preset): | |
| if preset == 'Family-Specific Auto-Recommendation': | |
| return 'Family-Specific Auto-Recommendation' | |
| elif family == 'Family-Specific Auto-Recommendation': | |
| return None | |
| else: | |
| return family | |
| target_identify_target_family.change( | |
| fn=update_preset, inputs=[target_identify_target_family, target_identify_preset], | |
| outputs=target_identify_preset, show_progress='hidden') | |
| target_identify_preset.change( | |
| fn=update_family, inputs=[target_identify_target_family, target_identify_preset], | |
| outputs=target_identify_target_family, show_progress='hidden') | |
| target_identify_click = target_identify_btn.click( | |
| fn=target_identify_validate, | |
| inputs=[compound_smiles, target_library, target_library_upload, target_identify_preset, target_identify_task, | |
| target_identify_email, run_state], | |
| outputs=[identify_data_for_predict, run_state], | |
| concurrency_limit=2, | |
| ) | |
| target_identify_lookup = target_identify_click.success( | |
| fn=lambda: gr.Tabs(selected='Prediction Status Lookup'), outputs=[tabs], | |
| ).then( | |
| fn=fill_job_id, inputs=[run_state], outputs=[pred_lookup_id] | |
| ).then( | |
| fn=lookup_job, | |
| inputs=[pred_lookup_id], | |
| outputs=[pred_lookup_status, pred_lookup_btn, pred_lookup_stop_btn, tabs, file_for_report], | |
| show_progress='minimal', | |
| concurrency_limit=100 | |
| ) | |
| target_identify_click.success( | |
| fn=send_email, | |
| inputs=[run_state] | |
| ) | |
| target_identify_click.success( | |
| fn=submit_predict, | |
| inputs=[identify_data_for_predict, target_identify_task, target_identify_preset, | |
| target_identify_target_family, target_identify_opts, run_state, ], # , target_identify_email], | |
| outputs=[run_state, ] | |
| ) | |
| pair_infer_click = pair_infer_btn.click( | |
| fn=pair_infer_validate, | |
| inputs=[infer_pair, infer_drug, infer_target, pair_infer_preset, pair_infer_task, | |
| pair_infer_email, run_state], | |
| outputs=[infer_data_for_predict, run_state], | |
| concurrency_limit=2, | |
| ) | |
| pair_infer_lookup = pair_infer_click.success( | |
| fn=lambda: gr.Tabs(selected='Prediction Status Lookup'), outputs=[tabs], | |
| ).then( | |
| fn=fill_job_id, inputs=[run_state], outputs=[pred_lookup_id] | |
| ).then( | |
| fn=lookup_job, | |
| inputs=[pred_lookup_id], | |
| outputs=[pred_lookup_status, pred_lookup_btn, pred_lookup_stop_btn, tabs, file_for_report], | |
| show_progress='minimal', | |
| concurrency_limit=100 | |
| ) | |
| pair_infer_click.success( | |
| fn=send_email, | |
| inputs=[run_state] | |
| ) | |
| pair_infer_click.success( | |
| fn=submit_predict, | |
| inputs=[infer_data_for_predict, pair_infer_task, pair_infer_preset, | |
| pair_infer_target_family, pair_infer_opts, run_state, ], # , pair_infer_email], | |
| outputs=[run_state, ] | |
| ) | |
| pred_lookup_click = pred_lookup_btn.click( | |
| fn=lookup_job, | |
| inputs=[pred_lookup_id], | |
| outputs=[pred_lookup_status, pred_lookup_btn, pred_lookup_stop_btn, tabs, file_for_report], | |
| show_progress='minimal', | |
| cancels=[drug_screen_lookup, target_identify_lookup, pair_infer_lookup], | |
| concurrency_limit=100, | |
| ) | |
| pred_lookup_stop_btn.click( | |
| fn=lambda: [gr.Button(visible=True), gr.Button(visible=False)], | |
| outputs=[pred_lookup_btn, pred_lookup_stop_btn], | |
| cancels=[pred_lookup_click, drug_screen_lookup, target_identify_lookup, pair_infer_lookup], | |
| concurrency_limit=None, | |
| ) | |
| def inquire_task(df): | |
| if 'Y' in df.columns: | |
| label = 'actual CPI/CPA labels (`Y`)' | |
| elif 'Y^' in df.columns: | |
| label = 'predicted CPI/CPA labels (`Y^`)' | |
| else: | |
| return {analyze_btn: gr.Button(interactive=True), | |
| csv_generate: gr.Button(interactive=True), | |
| html_generate: gr.Button(interactive=True)} | |
| return {report_task: gr.Dropdown(visible=True, | |
| info=f'Found {label} in your uploaded dataset. ' | |
| 'Is it compound-protein interaction or binding affinity?'), | |
| html_report: '', | |
| analyze_btn: gr.Button(interactive=False), | |
| csv_generate: gr.Button(interactive=False), | |
| html_generate: gr.Button(interactive=False)} | |
| report_df_change = file_for_report.change( | |
| fn=update_df, inputs=file_for_report, outputs=[html_report, raw_df, report_df, analyze_btn, report_task], | |
| concurrency_limit=100, | |
| ).success( | |
| fn=lambda: [gr.Button(interactive=True)] * 2, | |
| outputs=[csv_generate, html_generate], | |
| ) | |
| file_for_report.upload( | |
| fn=update_df, inputs=file_for_report, outputs=[html_report, raw_df, report_df, analyze_btn, report_task], | |
| cancels=[report_df_change], | |
| concurrency_limit=100, | |
| ).success( | |
| fn=inquire_task, inputs=[raw_df], | |
| outputs=[report_task, html_report, analyze_btn, csv_generate, html_generate], | |
| ) | |
| file_for_report.clear( | |
| fn=lambda: [gr.Button(interactive=False)] * 3 + | |
| [gr.File(visible=False, value=None)] * 2 + | |
| [gr.Dropdown(visible=False, value=None), ''], | |
| cancels=[report_df_change], | |
| outputs=[ | |
| csv_generate, html_generate, analyze_btn, csv_download_file, html_download_file, report_task, html_report | |
| ] | |
| ) | |
| analyze_btn.click( | |
| fn=submit_report, inputs=[raw_df, scores, filters, report_task], outputs=[ | |
| html_report, report_df, csv_download_file, html_download_file] | |
| ).success( | |
| fn=lambda: [gr.Button(interactive=True)] * 2, | |
| outputs=[csv_generate, html_generate], | |
| concurrency_limit=100, | |
| ) | |
| def create_csv_report_file(df, file_report, task, sep, progress=gr.Progress(track_tqdm=True)): | |
| csv_sep_map = { | |
| 'Comma': ',', | |
| 'Tab': '\t', | |
| } | |
| y_colname = 'Y^' | |
| if isinstance(task, str): | |
| if task == 'Compound-Protein Interaction': | |
| y_colname = 'Y^_prob' | |
| elif task == 'Compound-Protein Binding Affinity': | |
| y_colname = 'Y^_pIC50' | |
| try: | |
| now = datetime.now().strftime("%Y-%m-%d_%H-%M-%S") | |
| filename = f"{SERVER_DATA_DIR}/{Path(file_report.name).stem}_DeepSEQreen_report_{now}.csv" | |
| df.rename(columns={'Y^': y_colname}).drop( | |
| labels=['Compound', 'Scaffold'], axis=1 | |
| ).to_csv(filename, index=False, na_rep='', sep=csv_sep_map[sep]) | |
| return gr.File(filename, visible=True) | |
| except Exception as e: | |
| gr.Warning(f"Failed to generate CSV due to error: {str(e)}") | |
| return None | |
| def create_html_report_file(df, file_report, task, opts, progress=gr.Progress(track_tqdm=True)): | |
| try: | |
| now = datetime.now().strftime("%Y-%m-%d_%H-%M-%S") | |
| filename = f"{SERVER_DATA_DIR}/{Path(file_report.name).stem}_DeepSEQreen_report_{now}.html" | |
| create_html_report(df, filename, task, opts) | |
| return gr.File(filename, visible=True) | |
| except Exception as e: | |
| gr.Warning(f"Failed to generate HTML due to error: {str(e)}") | |
| return None | |
| # html_report.change(lambda: [gr.Button(visible=True)] * 2, outputs=[csv_generate, html_generate]) | |
| csv_generate.click( | |
| lambda: gr.File(visible=True), outputs=csv_download_file, | |
| ).then(fn=create_csv_report_file, inputs=[report_df, file_for_report, report_task, csv_sep], | |
| outputs=csv_download_file, show_progress='full') | |
| html_generate.click( | |
| lambda: gr.File(visible=True), outputs=html_download_file, | |
| ).then(fn=create_html_report_file, inputs=[report_df, file_for_report, report_task, html_opts], | |
| outputs=html_download_file, show_progress='full') | |
| if __name__ == "__main__": | |
| pandarallel.initialize() | |
| hydra.initialize(version_base="1.3", config_path="configs", job_name="webserver_inference") | |
| demo.queue(default_concurrency_limit=None, max_size=10).launch(show_api=False) | |
| scheduler.add_job(check_expiry, 'interval', hours=1) | |
| scheduler.start() |