Spaces:
Runtime error
Runtime error
| from fastapi import FastAPI, Form | |
| from fastapi.middleware.cors import CORSMiddleware | |
| from fastapi.staticfiles import StaticFiles | |
| from fastapi.responses import FileResponse | |
| from typing import Dict, List, Any, Tuple | |
| import pickle | |
| import math | |
| import re | |
| import gc | |
| from utils import split | |
| import torch | |
| from build_vocab import WordVocab | |
| from pretrain_trfm import TrfmSeq2seq | |
| from transformers import T5EncoderModel, T5Tokenizer | |
| import numpy as np | |
| app = FastAPI() | |
| # Add CORS middleware | |
| app.add_middleware( | |
| CORSMiddleware, | |
| allow_origins=["*"], | |
| allow_methods=["*"], | |
| allow_headers=["*"] | |
| ) | |
| tokenizer = T5Tokenizer.from_pretrained( | |
| "Rostlab/prot_t5_xl_half_uniref50-enc", do_lower_case=False, torch_dtype=torch.float16) | |
| model = T5EncoderModel.from_pretrained( | |
| "Rostlab/prot_t5_xl_half_uniref50-enc") | |
| #app.mount("/", StaticFiles(directory="static", html=True), name="static") | |
| def home(): | |
| smiles = "CC1=CC(=C(C=C1)C(=O)O)O" | |
| sequence = "MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKAGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG" | |
| endpointHandler = EndpointHandler() | |
| result = endpointHandler.predict({ | |
| "inputs": { | |
| "sequence": sequence, | |
| "smiles": smiles | |
| } | |
| }) | |
| return result | |
| # return FileResponse(path="/app/static/index.html", media_type="text/html") | |
| class EndpointHandler(): | |
| def __init__(self, path=""): | |
| self.tokenizer = tokenizer | |
| self.model = model | |
| # path to the vocab_content and trfm model | |
| vocab_content_path = "vocab_content.txt" | |
| trfm_path = "trfm_12_23000.pkl" | |
| # load the vocab_content instead of the pickle file | |
| with open(vocab_content_path, "r", encoding="utf-8") as f: | |
| vocab_content = f.read().strip().split("\n") | |
| # load the vocab and trfm model | |
| self.vocab = WordVocab(vocab_content) | |
| self.trfm = TrfmSeq2seq(len(self.vocab), 256, len(self.vocab), 4) | |
| device = torch.device('cuda:0' if torch.cuda.is_available() else 'cpu') | |
| self.trfm.load_state_dict(torch.load(trfm_path), map_location=device) | |
| self.trfm.eval() | |
| # path to the pretrained models | |
| self.Km_model_path = "Km.pkl" | |
| self.Kcat_model_path = "Kcat.pkl" | |
| self.Kcat_over_Km_model_path = "Kcat_over_Km.pkl" | |
| # vocab indices | |
| self.pad_index = 0 | |
| self.unk_index = 1 | |
| self.eos_index = 2 | |
| self.sos_index = 3 | |
| def predict(self, data: Dict[str, Any]) -> List[Dict[str, Any]]: | |
| """ | |
| Function where the endpoint logic is implemented. | |
| Args: | |
| data (Dict[str, Any]): The input data for the endpoint. It only contain a single key "inputs" which is a list of dictionaries. The dictionary contains the following keys: | |
| - sequence (str): Amino acid sequence. | |
| - smiles (str): SMILES representation of the molecule. | |
| Returns: | |
| Dict[str, Any]: The output data for the endpoint. The dictionary contains the following keys: | |
| - Km (float): float of predicted Km value. | |
| - Kcat (float): float of predicted Kcat value. | |
| - Vmax (float): float of predicted Vmax value. | |
| """ | |
| sequence = data["inputs"]["sequence"] | |
| smiles = data["inputs"]["smiles"] | |
| seq_vec = self.Seq_to_vec(sequence) | |
| smiles_vec = self.smiles_to_vec(smiles) | |
| fused_vector = np.concatenate((smiles_vec, seq_vec), axis=1) | |
| pred_Km = self.predict_feature_using_model( | |
| fused_vector, self.Km_model_path) | |
| pred_Kcat = self.predict_feature_using_model( | |
| fused_vector, self.Kcat_model_path) | |
| pred_Vmax = self.predict_feature_using_model( | |
| fused_vector, self.Kcat_over_Km_model_path) | |
| result = { | |
| "Km": pred_Km, | |
| "Kcat": pred_Kcat, | |
| "Vmax": pred_Vmax, | |
| } | |
| return result | |
| def predict_feature_using_model(self, X: np.array, model_path: str) -> float: | |
| """ | |
| Function to predict the feature using the pretrained model. | |
| """ | |
| with open(model_path, "rb") as f: | |
| model = pickle.load(f) | |
| pred_feature = model.predict(X) | |
| pred_feature_pow = math.pow(10, pred_feature) | |
| return pred_feature_pow | |
| def smiles_to_vec(self, Smiles: str) -> np.array: | |
| """ | |
| Function to convert the smiles to a vector using the pretrained model. | |
| """ | |
| Smiles = [Smiles] | |
| x_split = [split(sm) for sm in Smiles] | |
| xid, xseg = self.get_array(x_split, self.vocab) | |
| X = self.trfm.encode(torch.t(xid)) | |
| return X | |
| def get_inputs(self, sm: str, vocab: WordVocab) -> Tuple[List[int], List[int]]: | |
| """ | |
| Convert smiles to tensor | |
| """ | |
| seq_len = len(sm) | |
| sm = sm.split() | |
| ids = [vocab.stoi.get(token, self.unk_index) for token in sm] | |
| ids = [self.sos_index] + ids + [self.eos_index] | |
| seg = [1]*len(ids) | |
| padding = [self.pad_index]*(seq_len - len(ids)) | |
| ids.extend(padding), seg.extend(padding) | |
| return ids, seg | |
| def get_array(self, smiles: list[str], vocab: WordVocab) -> Tuple[torch.tensor, torch.tensor]: | |
| """ | |
| Convert smiles to tensor | |
| """ | |
| x_id, x_seg = [], [] | |
| for sm in smiles: | |
| a,b = self.get_inputs(sm, vocab) | |
| x_id.append(a) | |
| x_seg.append(b) | |
| return torch.tensor(x_id), torch.tensor(x_seg) | |
| def Seq_to_vec(self, Sequence: str) -> np.array: | |
| """ | |
| Function to convert the sequence to a vector using the pretrained model. | |
| """ | |
| Sequence = [Sequence] | |
| sequences_Example = [] | |
| for i in range(len(Sequence)): | |
| zj = '' | |
| for j in range(len(Sequence[i]) - 1): | |
| zj += Sequence[i][j] + ' ' | |
| zj += Sequence[i][-1] | |
| sequences_Example.append(zj) | |
| gc.collect() | |
| print(torch.cuda.is_available()) | |
| device = torch.device('cuda:0' if torch.cuda.is_available() else 'cpu') | |
| self.model = self.model.to(device) | |
| self.model = self.model.eval() | |
| features = [] | |
| for i in range(len(sequences_Example)): | |
| sequences_Example_i = sequences_Example[i] | |
| sequences_Example_i = [re.sub(r"[UZOB]", "X", sequences_Example_i)] | |
| ids = self.tokenizer.batch_encode_plus(sequences_Example_i, add_special_tokens=True, padding=True) | |
| input_ids = torch.tensor(ids['input_ids']).to(device) | |
| attention_mask = torch.tensor(ids['attention_mask']).to(device) | |
| with torch.no_grad(): | |
| embedding = self.model(input_ids=input_ids, attention_mask=attention_mask) | |
| embedding = embedding.last_hidden_state.cpu().numpy() | |
| for seq_num in range(len(embedding)): | |
| seq_len = (attention_mask[seq_num] == 1).sum() | |
| seq_emd = embedding[seq_num][:seq_len - 1] | |
| features.append(seq_emd) | |
| features_normalize = np.zeros([len(features), len(features[0][0])], dtype=float) | |
| for i in range(len(features)): | |
| for k in range(len(features[0][0])): | |
| for j in range(len(features[i])): | |
| features_normalize[i][k] += features[i][j][k] | |
| features_normalize[i][k] /= len(features[i]) | |
| return features_normalize | |