Spaces:
Paused
Paused
#ref: https://huggingface.co/blog/AmelieSchreiber/esmbind | |
import gradio as gr | |
import os | |
# os.environ["CUDA_VISIBLE_DEVICES"] = "0" | |
#import wandb | |
import numpy as np | |
import torch | |
import torch.nn as nn | |
import pickle | |
import xml.etree.ElementTree as ET | |
from datetime import datetime | |
from sklearn.model_selection import train_test_split | |
from sklearn.utils.class_weight import compute_class_weight | |
from sklearn.metrics import ( | |
accuracy_score, | |
precision_recall_fscore_support, | |
roc_auc_score, | |
matthews_corrcoef | |
) | |
from transformers import ( | |
AutoModelForTokenClassification, | |
AutoTokenizer, | |
DataCollatorForTokenClassification, | |
TrainingArguments, | |
Trainer | |
) | |
from peft import PeftModel | |
from datasets import Dataset | |
from accelerate import Accelerator | |
# Imports specific to the custom peft lora model | |
from peft import get_peft_config, PeftModel, PeftConfig, get_peft_model, LoraConfig, TaskType | |
# Helper Functions and Data Preparation | |
def truncate_labels(labels, max_length): | |
"""Truncate labels to the specified max_length.""" | |
return [label[:max_length] for label in labels] | |
def compute_metrics(p): | |
"""Compute metrics for evaluation.""" | |
predictions, labels = p | |
predictions = np.argmax(predictions, axis=2) | |
# Remove padding (-100 labels) | |
predictions = predictions[labels != -100].flatten() | |
labels = labels[labels != -100].flatten() | |
# Compute accuracy | |
accuracy = accuracy_score(labels, predictions) | |
# Compute precision, recall, F1 score, and AUC | |
precision, recall, f1, _ = precision_recall_fscore_support(labels, predictions, average='binary') | |
auc = roc_auc_score(labels, predictions) | |
# Compute MCC | |
mcc = matthews_corrcoef(labels, predictions) | |
return {'accuracy': accuracy, 'precision': precision, 'recall': recall, 'f1': f1, 'auc': auc, 'mcc': mcc} | |
def compute_loss(model, inputs): | |
"""Custom compute_loss function.""" | |
logits = model(**inputs).logits | |
labels = inputs["labels"] | |
loss_fct = nn.CrossEntropyLoss(weight=class_weights) | |
active_loss = inputs["attention_mask"].view(-1) == 1 | |
active_logits = logits.view(-1, model.config.num_labels) | |
active_labels = torch.where( | |
active_loss, labels.view(-1), torch.tensor(loss_fct.ignore_index).type_as(labels) | |
) | |
loss = loss_fct(active_logits, active_labels) | |
return loss | |
# Load the data from pickle files (replace with your local paths) | |
with open("./datasets/train_sequences_chunked_by_family.pkl", "rb") as f: | |
train_sequences = pickle.load(f) | |
with open("./datasets/test_sequences_chunked_by_family.pkl", "rb") as f: | |
test_sequences = pickle.load(f) | |
with open("./datasets/train_labels_chunked_by_family.pkl", "rb") as f: | |
train_labels = pickle.load(f) | |
with open("./datasets/test_labels_chunked_by_family.pkl", "rb") as f: | |
test_labels = pickle.load(f) | |
# Tokenization | |
tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t12_35M_UR50D") | |
max_sequence_length = 1000 | |
train_tokenized = tokenizer(train_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False) | |
test_tokenized = tokenizer(test_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False) | |
# Directly truncate the entire list of labels | |
train_labels = truncate_labels(train_labels, max_sequence_length) | |
test_labels = truncate_labels(test_labels, max_sequence_length) | |
train_dataset = Dataset.from_dict({k: v for k, v in train_tokenized.items()}).add_column("labels", train_labels) | |
test_dataset = Dataset.from_dict({k: v for k, v in test_tokenized.items()}).add_column("labels", test_labels) | |
# Compute Class Weights | |
classes = [0, 1] | |
flat_train_labels = [label for sublist in train_labels for label in sublist] | |
class_weights = compute_class_weight(class_weight='balanced', classes=classes, y=flat_train_labels) | |
accelerator = Accelerator() | |
class_weights = torch.tensor(class_weights, dtype=torch.float32).to(accelerator.device) | |
# inference | |
# Path to the saved LoRA model | |
model_path = "AmelieSchreiber/esm2_t12_35M_lora_binding_sites_v2_cp3" | |
# ESM2 base model | |
base_model_path = "facebook/esm2_t12_35M_UR50D" | |
# Load the model | |
base_model = AutoModelForTokenClassification.from_pretrained(base_model_path) | |
loaded_model = PeftModel.from_pretrained(base_model, model_path) | |
# Ensure the model is in evaluation mode | |
loaded_model.eval() | |
# Protein sequence for inference | |
protein_sequence = "MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT" # Replace with your actual sequence | |
# Tokenize the sequence | |
inputs = tokenizer(protein_sequence, return_tensors="pt", truncation=True, max_length=1024, padding='max_length') | |
# Run the model | |
with torch.no_grad(): | |
logits = loaded_model(**inputs).logits | |
# Get predictions | |
tokens = tokenizer.convert_ids_to_tokens(inputs["input_ids"][0]) # Convert input ids back to tokens | |
predictions = torch.argmax(logits, dim=2) | |
# debug result | |
dubug_result = predictions #class_weights | |
demo = gr.Blocks(title="DEMO FOR ESM2Bind") | |
with demo: | |
gr.Markdown("# DEMO FOR ESM2Bind") | |
gr.Textbox(dubug_result) | |
demo.launch() |