Spaces:
Paused
Paused
#ref: https://huggingface.co/blog/AmelieSchreiber/esmbind | |
import gradio as gr | |
import os | |
# os.environ["CUDA_VISIBLE_DEVICES"] = "0" | |
#import wandb | |
import numpy as np | |
import torch | |
import torch.nn as nn | |
import pickle | |
import xml.etree.ElementTree as ET | |
from datetime import datetime | |
from sklearn.model_selection import train_test_split | |
from sklearn.utils.class_weight import compute_class_weight | |
from sklearn.metrics import ( | |
accuracy_score, | |
precision_recall_fscore_support, | |
roc_auc_score, | |
matthews_corrcoef | |
) | |
from transformers import ( | |
AutoModelForTokenClassification, | |
AutoTokenizer, | |
DataCollatorForTokenClassification, | |
TrainingArguments, | |
Trainer | |
) | |
from peft import PeftModel | |
from datasets import Dataset | |
from accelerate import Accelerator | |
# Imports specific to the custom peft lora model | |
from peft import get_peft_config, PeftModel, PeftConfig, get_peft_model, LoraConfig, TaskType | |
# Helper Functions and Data Preparation | |
def truncate_labels(labels, max_length): | |
"""Truncate labels to the specified max_length.""" | |
return [label[:max_length] for label in labels] | |
def compute_metrics(p): | |
"""Compute metrics for evaluation.""" | |
predictions, labels = p | |
predictions = np.argmax(predictions, axis=2) | |
# Remove padding (-100 labels) | |
predictions = predictions[labels != -100].flatten() | |
labels = labels[labels != -100].flatten() | |
# Compute accuracy | |
accuracy = accuracy_score(labels, predictions) | |
# Compute precision, recall, F1 score, and AUC | |
precision, recall, f1, _ = precision_recall_fscore_support(labels, predictions, average='binary') | |
auc = roc_auc_score(labels, predictions) | |
# Compute MCC | |
mcc = matthews_corrcoef(labels, predictions) | |
return {'accuracy': accuracy, 'precision': precision, 'recall': recall, 'f1': f1, 'auc': auc, 'mcc': mcc} | |
def compute_loss(model, inputs): | |
"""Custom compute_loss function.""" | |
logits = model(**inputs).logits | |
labels = inputs["labels"] | |
loss_fct = nn.CrossEntropyLoss(weight=class_weights) | |
active_loss = inputs["attention_mask"].view(-1) == 1 | |
active_logits = logits.view(-1, model.config.num_labels) | |
active_labels = torch.where( | |
active_loss, labels.view(-1), torch.tensor(loss_fct.ignore_index).type_as(labels) | |
) | |
loss = loss_fct(active_logits, active_labels) | |
return loss | |
# fine-tuning function | |
def train_function_no_sweeps(base_model_path, train_dataset, test_dataset): | |
# Set the LoRA config | |
config = { | |
"lora_alpha": 1, #try 0.5, 1, 2, ..., 16 | |
"lora_dropout": 0.2, | |
"lr": 5.701568055793089e-04, | |
"lr_scheduler_type": "cosine", | |
"max_grad_norm": 0.5, | |
"num_train_epochs": 3, | |
"per_device_train_batch_size": 12, | |
"r": 2, | |
"weight_decay": 0.2, | |
# Add other hyperparameters as needed | |
} | |
# The base model you will train a LoRA on top of | |
base_model_path = "facebook/esm2_t12_35M_UR50D" | |
# Define labels and model | |
id2label = {0: "No binding site", 1: "Binding site"} | |
label2id = {v: k for k, v in id2label.items()} | |
base_model = AutoModelForTokenClassification.from_pretrained(base_model_path, num_labels=len(id2label), id2label=id2label, label2id=label2id) | |
# Convert the model into a PeftModel | |
peft_config = LoraConfig( | |
task_type=TaskType.TOKEN_CLS, | |
inference_mode=False, | |
r=config["r"], | |
lora_alpha=config["lora_alpha"], | |
target_modules=["query", "key", "value"], # also try "dense_h_to_4h" and "dense_4h_to_h" | |
lora_dropout=config["lora_dropout"], | |
bias="none" # or "all" or "lora_only" | |
) | |
base_model = get_peft_model(base_model, peft_config) | |
# Use the accelerator | |
base_model = accelerator.prepare(base_model) | |
train_dataset = accelerator.prepare(train_dataset) | |
test_dataset = accelerator.prepare(test_dataset) | |
timestamp = datetime.now().strftime('%Y-%m-%d_%H-%M-%S') | |
# Training setup | |
training_args = TrainingArguments( | |
output_dir=f"esm2_t12_35M-lora-binding-sites_{timestamp}", | |
learning_rate=config["lr"], | |
lr_scheduler_type=config["lr_scheduler_type"], | |
gradient_accumulation_steps=1, | |
max_grad_norm=config["max_grad_norm"], | |
per_device_train_batch_size=config["per_device_train_batch_size"], | |
per_device_eval_batch_size=config["per_device_train_batch_size"], | |
num_train_epochs=config["num_train_epochs"], | |
weight_decay=config["weight_decay"], | |
evaluation_strategy="epoch", | |
save_strategy="epoch", | |
load_best_model_at_end=True, | |
metric_for_best_model="f1", | |
greater_is_better=True, | |
push_to_hub=False, | |
logging_dir=None, | |
logging_first_step=False, | |
logging_steps=200, | |
save_total_limit=7, | |
no_cuda=False, | |
seed=8893, | |
fp16=True, | |
#report_to='wandb' | |
report_to=None | |
) | |
# Initialize Trainer | |
trainer = WeightedTrainer( | |
model=base_model, | |
args=training_args, | |
train_dataset=train_dataset, | |
eval_dataset=test_dataset, | |
tokenizer=tokenizer, | |
data_collator=DataCollatorForTokenClassification(tokenizer=tokenizer), | |
compute_metrics=compute_metrics | |
) | |
# Train and Save Model | |
trainer.train() | |
save_path = os.path.join("lora_binding_sites", f"best_model_esm2_t12_35M_lora_{timestamp}") | |
trainer.save_model(save_path) | |
tokenizer.save_pretrained(save_path) | |
return save_path | |
# Load the data from pickle files (replace with your local paths) | |
with open("./datasets/train_sequences_chunked_by_family.pkl", "rb") as f: | |
train_sequences = pickle.load(f) | |
with open("./datasets/test_sequences_chunked_by_family.pkl", "rb") as f: | |
test_sequences = pickle.load(f) | |
with open("./datasets/train_labels_chunked_by_family.pkl", "rb") as f: | |
train_labels = pickle.load(f) | |
with open("./datasets/test_labels_chunked_by_family.pkl", "rb") as f: | |
test_labels = pickle.load(f) | |
# Tokenization | |
tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t12_35M_UR50D") | |
max_sequence_length = 1000 | |
train_tokenized = tokenizer(train_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False) | |
test_tokenized = tokenizer(test_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False) | |
# Directly truncate the entire list of labels | |
train_labels = truncate_labels(train_labels, max_sequence_length) | |
test_labels = truncate_labels(test_labels, max_sequence_length) | |
train_dataset = Dataset.from_dict({k: v for k, v in train_tokenized.items()}).add_column("labels", train_labels) | |
test_dataset = Dataset.from_dict({k: v for k, v in test_tokenized.items()}).add_column("labels", test_labels) | |
# Compute Class Weights | |
classes = [0, 1] | |
flat_train_labels = [label for sublist in train_labels for label in sublist] | |
class_weights = compute_class_weight(class_weight='balanced', classes=classes, y=flat_train_labels) | |
accelerator = Accelerator() | |
class_weights = torch.tensor(class_weights, dtype=torch.float32).to(accelerator.device) | |
# inference | |
# Path to the saved LoRA model | |
model_path = "AmelieSchreiber/esm2_t12_35M_lora_binding_sites_v2_cp3" | |
# ESM2 base model | |
base_model_path = "facebook/esm2_t12_35M_UR50D" | |
# Load the model | |
base_model = AutoModelForTokenClassification.from_pretrained(base_model_path) | |
loaded_model = PeftModel.from_pretrained(base_model, model_path) | |
# Ensure the model is in evaluation mode | |
loaded_model.eval() | |
# Protein sequence for inference | |
protein_sequence = "MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT" # Replace with your actual sequence | |
# Tokenize the sequence | |
inputs = tokenizer(protein_sequence, return_tensors="pt", truncation=True, max_length=1024, padding='max_length') | |
# Run the model | |
with torch.no_grad(): | |
logits = loaded_model(**inputs).logits | |
# Get predictions | |
tokens = tokenizer.convert_ids_to_tokens(inputs["input_ids"][0]) # Convert input ids back to tokens | |
predictions = torch.argmax(logits, dim=2) | |
# Define labels | |
id2label = { | |
0: "No binding site", | |
1: "Binding site" | |
} | |
# Print the predicted labels for each token | |
for token, prediction in zip(tokens, predictions[0].numpy()): | |
if token not in ['<pad>', '<cls>', '<eos>']: | |
print((token, id2label[prediction])) | |
# train | |
saved_path = train_function_no_sweeps(base_model_path,train_dataset, test_dataset) | |
# debug result | |
dubug_result = saved_path #predictions #class_weights | |
demo = gr.Blocks(title="DEMO FOR ESM2Bind") | |
with demo: | |
gr.Markdown("# DEMO FOR ESM2Bind") | |
gr.Textbox(dubug_result) | |
demo.launch() |