#ref: https://huggingface.co/blog/AmelieSchreiber/esmbind import gradio as gr import os # os.environ["CUDA_VISIBLE_DEVICES"] = "0" #import wandb import numpy as np import torch import torch.nn as nn import pickle import xml.etree.ElementTree as ET from datetime import datetime from sklearn.model_selection import train_test_split from sklearn.utils.class_weight import compute_class_weight from sklearn.metrics import ( accuracy_score, precision_recall_fscore_support, roc_auc_score, matthews_corrcoef ) from transformers import ( AutoModelForTokenClassification, AutoTokenizer, DataCollatorForTokenClassification, TrainingArguments, Trainer ) from peft import PeftModel from datasets import Dataset from accelerate import Accelerator # Imports specific to the custom peft lora model from peft import get_peft_config, PeftModel, PeftConfig, get_peft_model, LoraConfig, TaskType # Helper Functions and Data Preparation def truncate_labels(labels, max_length): """Truncate labels to the specified max_length.""" return [label[:max_length] for label in labels] def compute_metrics(p): """Compute metrics for evaluation.""" predictions, labels = p predictions = np.argmax(predictions, axis=2) # Remove padding (-100 labels) predictions = predictions[labels != -100].flatten() labels = labels[labels != -100].flatten() # Compute accuracy accuracy = accuracy_score(labels, predictions) # Compute precision, recall, F1 score, and AUC precision, recall, f1, _ = precision_recall_fscore_support(labels, predictions, average='binary') auc = roc_auc_score(labels, predictions) # Compute MCC mcc = matthews_corrcoef(labels, predictions) return {'accuracy': accuracy, 'precision': precision, 'recall': recall, 'f1': f1, 'auc': auc, 'mcc': mcc} def compute_loss(model, inputs): """Custom compute_loss function.""" logits = model(**inputs).logits labels = inputs["labels"] loss_fct = nn.CrossEntropyLoss(weight=class_weights) active_loss = inputs["attention_mask"].view(-1) == 1 active_logits = logits.view(-1, model.config.num_labels) active_labels = torch.where( active_loss, labels.view(-1), torch.tensor(loss_fct.ignore_index).type_as(labels) ) loss = loss_fct(active_logits, active_labels) return loss # Define Custom Trainer Class # Since we are using class weights, due to the imbalance between non-binding residues and binding residues, we will need a custom weighted trainer. class WeightedTrainer(Trainer): def compute_loss(self, model, inputs, return_outputs=False): outputs = model(**inputs) loss = compute_loss(model, inputs) return (loss, outputs) if return_outputs else loss # # fine-tuning function def train_function_no_sweeps(base_model_path): #, train_dataset, test_dataset): # Set the LoRA config config = { "lora_alpha": 1, #try 0.5, 1, 2, ..., 16 "lora_dropout": 0.2, "lr": 5.701568055793089e-04, "lr_scheduler_type": "cosine", "max_grad_norm": 0.5, "num_train_epochs": 1, #3, jw 20240628 "per_device_train_batch_size": 12, "r": 2, "weight_decay": 0.2, # Add other hyperparameters as needed } # The base model you will train a LoRA on top of #base_model_path = "facebook/esm2_t12_35M_UR50D" # Define labels and model id2label = {0: "No binding site", 1: "Binding site"} label2id = {v: k for k, v in id2label.items()} base_model = AutoModelForTokenClassification.from_pretrained(base_model_path, num_labels=len(id2label), id2label=id2label, label2id=label2id) ''' # Load the data from pickle files (replace with your local paths) with open("./datasets/train_sequences_chunked_by_family.pkl", "rb") as f: train_sequences = pickle.load(f) with open("./datasets/test_sequences_chunked_by_family.pkl", "rb") as f: test_sequences = pickle.load(f) with open("./datasets/train_labels_chunked_by_family.pkl", "rb") as f: train_labels = pickle.load(f) with open("./datasets/test_labels_chunked_by_family.pkl", "rb") as f: test_labels = pickle.load(f) ''' # Tokenization tokenizer = AutoTokenizer.from_pretrained(base_model_path) #("facebook/esm2_t12_35M_UR50D") #max_sequence_length = 1000 train_tokenized = tokenizer(train_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False) test_tokenized = tokenizer(test_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False) # Directly truncate the entire list of labels #train_labels = truncate_labels(train_labels, max_sequence_length) #test_labels = truncate_labels(test_labels, max_sequence_length) train_dataset = Dataset.from_dict({k: v for k, v in train_tokenized.items()}).add_column("labels", train_labels) test_dataset = Dataset.from_dict({k: v for k, v in test_tokenized.items()}).add_column("labels", test_labels) ''' # Compute Class Weights classes = [0, 1] flat_train_labels = [label for sublist in train_labels for label in sublist] class_weights = compute_class_weight(class_weight='balanced', classes=classes, y=flat_train_labels) accelerator = Accelerator() class_weights = torch.tensor(class_weights, dtype=torch.float32).to(accelerator.device) print(" class_weights:", class_weights) ''' # Convert the model into a PeftModel peft_config = LoraConfig( task_type=TaskType.TOKEN_CLS, inference_mode=False, r=config["r"], lora_alpha=config["lora_alpha"], target_modules=["query", "key", "value"], # also try "dense_h_to_4h" and "dense_4h_to_h" lora_dropout=config["lora_dropout"], bias="none" # or "all" or "lora_only" ) base_model = get_peft_model(base_model, peft_config) # Use the accelerator base_model = accelerator.prepare(base_model) train_dataset = accelerator.prepare(train_dataset) test_dataset = accelerator.prepare(test_dataset) timestamp = datetime.now().strftime('%Y-%m-%d_%H-%M-%S') # Training setup training_args = TrainingArguments( output_dir=f"esm2_t12_35M-lora-binding-sites_{timestamp}", learning_rate=config["lr"], lr_scheduler_type=config["lr_scheduler_type"], gradient_accumulation_steps=1, max_grad_norm=config["max_grad_norm"], per_device_train_batch_size=config["per_device_train_batch_size"], per_device_eval_batch_size=config["per_device_train_batch_size"], num_train_epochs=config["num_train_epochs"], weight_decay=config["weight_decay"], evaluation_strategy="epoch", save_strategy="epoch", load_best_model_at_end=True, metric_for_best_model="f1", greater_is_better=True, push_to_hub=True, #jw 20240701 False, logging_dir=None, logging_first_step=False, logging_steps=200, save_total_limit=7, no_cuda=False, seed=8893, fp16=True, #report_to='wandb' report_to=None, hub_token = HF_TOKEN, #jw 20240701 ) # Initialize Trainer trainer = WeightedTrainer( model=base_model, args=training_args, train_dataset=train_dataset, eval_dataset=test_dataset, tokenizer=tokenizer, data_collator=DataCollatorForTokenClassification(tokenizer=tokenizer), compute_metrics=compute_metrics ) # Train and Save Model trainer.train() save_path = os.path.join("lora_binding_sites", f"best_model_esm2_t12_35M_lora_{timestamp}") trainer.save_model(save_path) tokenizer.save_pretrained(save_path) return save_path # Constants & Globals HF_TOKEN = os.environ.get("HF_TOKEN") MODEL_OPTIONS = [ "facebook/esm2_t6_8M_UR50D", "facebook/esm2_t12_35M_UR50D", "facebook/esm2_t33_650M_UR50D", ] # models users can choose from PEFT_MODEL_OPTIONS = [ "AmelieSchreiber/esm2_t12_35M_lora_binding_sites_v2_cp3", ] # finetuned models # Load the data from pickle files (replace with your local paths) with open("./datasets/train_sequences_chunked_by_family.pkl", "rb") as f: train_sequences = pickle.load(f) with open("./datasets/test_sequences_chunked_by_family.pkl", "rb") as f: test_sequences = pickle.load(f) with open("./datasets/train_labels_chunked_by_family.pkl", "rb") as f: train_labels = pickle.load(f) with open("./datasets/test_labels_chunked_by_family.pkl", "rb") as f: test_labels = pickle.load(f) ## Tokenization #tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t12_35M_UR50D") max_sequence_length = 1000 #train_tokenized = tokenizer(train_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False) #test_tokenized = tokenizer(test_sequences, padding=True, truncation=True, max_length=max_sequence_length, return_tensors="pt", is_split_into_words=False) # Directly truncate the entire list of labels train_labels = truncate_labels(train_labels, max_sequence_length) test_labels = truncate_labels(test_labels, max_sequence_length) #train_dataset = Dataset.from_dict({k: v for k, v in train_tokenized.items()}).add_column("labels", train_labels) #test_dataset = Dataset.from_dict({k: v for k, v in test_tokenized.items()}).add_column("labels", test_labels) # Compute Class Weights classes = [0, 1] flat_train_labels = [label for sublist in train_labels for label in sublist] class_weights = compute_class_weight(class_weight='balanced', classes=classes, y=flat_train_labels) accelerator = Accelerator() class_weights = torch.tensor(class_weights, dtype=torch.float32).to(accelerator.device) ''' # inference # Path to the saved LoRA model model_path = "AmelieSchreiber/esm2_t12_35M_lora_binding_sites_v2_cp3" # ESM2 base model base_model_path = "facebook/esm2_t12_35M_UR50D" # Load the model base_model = AutoModelForTokenClassification.from_pretrained(base_model_path) loaded_model = PeftModel.from_pretrained(base_model, model_path) # Ensure the model is in evaluation mode loaded_model.eval() # Protein sequence for inference protein_sequence = "MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT" # Replace with your actual sequence # Tokenize the sequence inputs = tokenizer(protein_sequence, return_tensors="pt", truncation=True, max_length=1024, padding='max_length') # Run the model with torch.no_grad(): logits = loaded_model(**inputs).logits # Get predictions tokens = tokenizer.convert_ids_to_tokens(inputs["input_ids"][0]) # Convert input ids back to tokens predictions = torch.argmax(logits, dim=2) # Define labels id2label = { 0: "No binding site", 1: "Binding site" } # Print the predicted labels for each token for token, prediction in zip(tokens, predictions[0].numpy()): if token not in ['', '', '']: print((token, id2label[prediction])) # train saved_path = train_function_no_sweeps(base_model_path,train_dataset, test_dataset) # debug result dubug_result = saved_path #predictions #class_weights ''' demo = gr.Blocks(title="DEMO FOR ESM2Bind") with demo: gr.Markdown("# DEMO FOR ESM2Bind") #gr.Textbox(dubug_result) gr.Markdown("## Finetune Pre-trained Model") with gr.Column(): gr.Markdown("## Select a base model") gr.Markdown( """ Pick a base model and press **Finetune Pre-trained Model!""" ) with gr.Row(): with gr.Column(scale=0.5, variant="compact"): base_model_name = gr.Dropdown( choices=MODEL_OPTIONS, value=MODEL_OPTIONS[0], label="Base Model Name", interactive = True, ) finetune_button = gr.Button( value="Finetune Pre-trained Model", interactive=True, variant="primary", ) finetune_output_text = gr.Textbox( lines=1, max_lines=12, label="Finetune Status", placeholder="Finetune Status Shown Here", ) # "Finetune Pre-trained Model" actions finetune_button.click( fn = train_function_no_sweeps, inputs=[base_model_name], #finetune_dataset_name], outputs = [finetune_output_text], ) demo.launch()