UniProt ID
stringlengths 6
10
| Protein Sequence
stringlengths 2
35.2k
| Functional Description
stringlengths 5
30.7k
|
|---|---|---|
Q9AKR8
|
MAPKIFIDGEHGTTGLQIRTRMAGRRDVELLSIPEAERRNAAMREDMLNSADIAMLCLPDDASKEAVQMVSANNNVRVIDTSTAFRVNPGWAYGFAEMDKEQAEKIASARFVSNPGCYPTGAIGLIRPLRAAGILPDGYPVTVNAVSGYSGGGKQMIAQMENPDHPDAITAPHFLYGLPLTHKHVPEMTVHGLLDRAPIFSPSVGKFAQGMIVQVPLHLDDLAEGTTMESIHAALVAHYAGQEIVTVVPLSDSKALARVNAVELEGKDTMKLFVFGTPGGSQVNLVALLDNLGKAPRGVQNMDLMLAS
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 2 subfamily.
|
Q1MIP7
|
MAPKIFIDGEHGTTGLQIRTRMAGRRDVELLSIPEAERRNAAMREDMLNGADIAILCLPDDASKEAVQMVSANNNVRVIDTSTAFRVNPGWAYGFAEMDKQQADKIAAARFVANPGCYPTGAIGLIRPLRAAGILPDGYPITVNAVSGYTGGGKQMIAQMENPDHPDAITAPHFLYGLPLTHKHVPEMTVHGLLDRAPIFSPSVGKFAQGMIVQVPLHLDDLAEGTTMESIHAALVAHYAGQDIVSVVPLAESKALPRVNAIELEGKDTMKLFVFGTPGASQVNLVALLDNLGKGASGAAVQNMDLMLAS
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 2 subfamily.
|
Q982X3
|
MKPKIFIDGEHGTTGLQIRALLAERGDLEIISIPTERRKETAARAEFLNAADIAILCLPDDAAKESVSLITNDTTKVIDASTAHRVAEGWAYGFAEMDKEQAKAIATAKRVANPGCWPQGPIATLRPLVTSGLLPADFPITVNGISGYSGGGRPMIEDYVAKGEDASEFLPYGLTLQHKHVPELRAYAKLSHDPIMQPAVGNFAQGMITVVPLQLGGLDSVPTGAELHAAIADHFAAIKGGVVEVAPYAHLERMPEIDPEIYNGTNRMKVYVFANDKRAQALLLAVYDNLGKGASGAAVQNMDLMLGL
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 2 subfamily.
|
B5ZXZ1
|
MAPKIFIDGEHGTTGLQIRTRMAGRRDVELLSIPEAERRNAAMREDMLNSADIAILCLPDDASKEAVQMVSANNNVRVIDTSTAFRVNPGWAYGFAEMDGAQADRIKAARFVANPGCYPTGAIGLIRPLRAAGLLPDGYPVTVNAVSGYTGGGKQMIAQMENPDHPDAITAPHFLYGLPLTHKHVPEMTVHGLLDRAPIFSPSVGKFAQGMIVQVPLHLGDLAEGTTMESIHAALVAHYAGQEIVTVVPLAESKALSRVNAVELEGKDTMKLFVFGTPGASQVNLVALLDNLGKGASGAAVQNMDLMLAS
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 2 subfamily.
|
Q92QR7
|
MKPKIFIDGEHGTTGLQIRVRMAGRTDLELLSIPEAERRNAAMREDLLNSADIAILCLPDDASREAVAMVAGNNRVRIIDTSTAHRVAPDWAYGFAEMDKAQPQRIRDARHVANPGCYPTGAIALIRPLRQAGILPDGYPVTVNAVSGYTGGGKQMIAQMEDDQNPDHIGAPHFLYGLTLKHKHVPEMKMHGLLERAPVFSPSVGKFAQGMIVQVPLYLEDLAAGATLETIHRALVDHYAGQSIVEVVPLDESAKLARIDATELAGSDAMKLFVFGTKGGAHVNLVALLDNLGKGASGAAVQNMDLMLSA
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 2 subfamily.
|
Q7UVL4
|
MSSSNLRVALVGSTGYTALEVARLLLTHPGADLVVATSRQDEGKPLSEIHPMLAGRCDVTLQPLDADVIAKSADVAMCCLPHGASAESVKQLAEAGMRVIDFSADFRLSSLETYQHWYGVKHPWPERIGDVVYGMPEFFADEIRSADIVANPGCYPTSAIMPLAPLVKAGLIETDDIIVDSKSGVSGAGRSPKLGTLYCETNESISAYAVGTHRHAPEIADLVERIAGAPIEVMFTPHLTPMDRGILSTIYVKPVGKAGSVEDAVRAMMSLLRDTYSDQPCVHVVDHLPATKYVAGTNHVQISVRPSGKRAVIVCAIDNLTKGASGAAVQNMNVMFGLPETAGLLM
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 1 subfamily.
|
D5ANG4
|
MTQKIAILGASGYTGAELARIIATHPEMEITALSGDRKAGMRMGEVFPHLRHIGLPDLVKIEEIDFSGIDLAFCALPHATSQAVIAELPRDLKVVDLSADFRLRDAAEYEKWYGKPHAAMDLQAEAVYGLTEFYREELKTARLCAGTGCNAAAGQYAIRPLIEAGVIDLDEIVIDLKAGVSGAGRSLKENLLHAELAGGTMPYSAGGKHRHLGEFDQEFSKVAGRPVRVQFTPHLMPFNRGILATVYVRGTPEDIHAALASRYENEVFLEVLPFGQLASTRSVAGSNFVHLGVIGDRLPGRAVVTVALDNLTKGSSGQAIQNANLMLGLPETLGLMLAPVFP
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 1 subfamily. Extended N-terminus.
|
Q2RRM4
|
MSERVNVAILGASGYTGAELVRLLARHPRVTLAALTANRKAGQAFASVFPHLGGLDLPVLSTIEAVDWSAIDFVFCALPHGTTQTIIGDLLNGPHGGRLRIADLSADFRLADPMVYQTWYGHAHEAVELQKEAVYGLTEINRAAIATARLVAVPGCYPTSAQLPLIPLLRAGLIDPDAIIIDAKSGASGAGRDAKEGSLHCEVSEGIHAYGVGTHRHGPEIEQGLSLAVGRPVAVTFTPHLMPMNRGILSTIYLRATAGNDATTLRQALSAAYADEAFVRVVPEGVSPHTRHVRGSNFVLIGVHADRVPGRVIVTCVEDNLVKGASGQAIQDMNVMLGFPETLGLDQQPLFP
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 1 subfamily.
|
B7JY20
|
MGESERIPVGIIGASGYGGVQLVRLLLEHPQVEIAYLGGKGSAGKPYWDLYPHLSHLVNLTVEPIDLEVVASRCQVVFLGLPNGLACDMAPQLIAKGCKVLDLSADYRFRDLQTYTAWYNKDRSDTETAAKAVYGLPELYRTEIQSASLIGCPGCYPTASLMALSPLLKQGLILPETAIIDAKSGTSGGGRQEKIHLLLAEAEGSLGAYGVAKHRHTPEIEQVCSDLAGHEVKVQFTPHLIPMVRGILSTVYASLRDPGLVRDDILTIYSAFYRSSPFVKILPHGIYPQTKWAWGTNLCYIGIETDPRTDRVIVLSAIDNLMKGQAGQAVQCLNLMMGWEETLGLPQLSFYP
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 1 subfamily.
|
Q163W4
|
MTYSIAILGASGYTGAELIRLIAGHSALKITALGAFSKAGQSVAQVFPHLRHLDLPALLQIDQIDFANIDLCFCALPHKTSQEVIAALPSDLKVVDLSADFRLRDPDAYEKWYGNKHAALKQQAEAVYGLTEFYRDDIKTARLVAGTGCNAATGQYMLRPLITAGVIDLDDIILDLKCAVSGAGRSLKENLLHAELSEGYHAYATGSTHRHLGEFDQEFSKLAGRPVQIQFTPHLIPANRGILGTGYLRGEAAQIHDTLSQAYANEPFIDVLPFGETPSTRHVRGSNFCHIGVVADRQPGRALVVAALDNLTKGSSGQALQNANLMLNIKETEGLMMPPLFP
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 1 subfamily.
|
Q1AS32
|
MGLSVGIYGGSGYVGVELVRLLAGHPEVGSLAVASRGHAGRRIGEVYPQVAVGGEYLDPSEVDVSSLDVAFVAYGHGESAEAVRGLLEGGVRLVVDLSADFRLPDVRVYEEWYGEHPAPELLGEAHYGLPEVFGALEGRLVANPGCYPTAAILALAPVVRRMGGEVRSVTINALSGVSGAGAKPSARTHFVSVNESVSPYGVSGGEPRHRHTPEIEIMLRRLGEAPPVTFVPHLLPISRGELETITVEAGELPGAEEVLGWYREDYGGWRFVEAREEVPHISHVANTNRARLSAAVDRRAGKLLLFAAVDNLLKGAAGEAVQNMNLALGYPEDLGLEHLR
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 1 subfamily.
|
Q5LS92
|
MTHKIAILGASGYTGAELVRLIAEHPNMEIVALSGERKAGQSMAEVFPHLRHLDLPVLCKIDEIDFAGVDLCFCALPHKTSQEVIRALPATLKIVDLSADFRLRDPEAYRTWYGNEHVALEQQAEAVYGLTEFYRDQIRTARLVAGTGCNAATGQYVLRPLIAAGVIDLDEIILDLKCAVSGAGRSLKENLLHAELSEGANAYAVGGTHRHLGEFDQEFSALAGRPVQVQFTPHLIPANRGILATTYVRGDAQTVFQTLAAAYADEPFVHVLPFGETPSTHHVRGSNHCHIGVTGDRIAGRAIVIAALDNLTKGSSGQALQNANLMLGETETTGLTMAPLFP
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 1 subfamily.
|
Q1GHL0
|
MTHNVAILGASGYTGAELIRLISQHPSITIKALAAERKAGMEMADVFPHLRHLSLPTLCKIDEIDFAQIDLCFCALPHKTSQEVIAKLPGDLKIVDLSADFRLRDPEAYEKWYGNPHAALEQQQEAVYGLTEFYRDEIKGARLVAGTGCNAATGQFALRPLIAAGVIDLDEIILDMKCAVSGAGRALKENLLHAELSEGYNAYAIGGTHRHIGEFDQEFSAIAGRPVKVQFTPHLLPVNRGILATTYVKGDAQAIYETFAKAYADEPFVELLPFGEAPSTHHVRGSNFVHIGVTADRIAGRAIVIVALDNLTKGSSGQALQNANLMLGEDETAGLMMAPLFP
|
Catalyzes the NADPH-dependent reduction of N-acetyl-5-glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. N-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = H(+) + N-acetyl-L-glutamyl 5-phosphate + NADPH Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 3/4. Belongs to the NAGSA dehydrogenase family. Type 1 subfamily.
|
Q9LCS5
|
MSNQEFAQRWQGVMIDSYGTPGLSFVRGEGSTLWDADGTAYTDFVSGLAVNALGHAHPAVVGAVSRQIASLGHISNFYSAEPTITLAERLIELFGRPGRVFFCNSGAEANETAFKIGRLTGRSRIVAAQSGFHGRTMGSLALTGQPAKREPFLPLPGDVTHVPYGDAEALRAAVTEDTAMVILEPIQGESGVVVPPKGYLRAAREITEATGTLLVLDEVQTGIGRTGHWFAAQAEGVEADVVTLAKGLGGGLPLGAAVAFGRAAELMTPGHHASTFGGNPVSCARTRVLDTIAADGLLDRVKQLGSAPDEWSVRDAAAIRWSPMSGAGLMLGIVLNEPLAPQVQLAAQKAGFLVNVPAPDVVRLIPPLVIEETEVDAFLQALPGLLDAVHERDREGQTGE
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
Q9L1A4
|
MSNEELTERWQGTLMNNYGTPRLPLVRGEGARLWDADGKEYLDFVGGIAVNALGHAHPAVVDAVSRQIASLGHVSNLFIAEPPVALAERLLQHFGRDGKVYFCNSGAEANEGAFKIGRLTGRPHMVATRGGFHGRTMGALALTGQPGKQEPFLPLPGDVTHVPYGDPQALAAAVTEETALVIIEPIQGENGVVVPPPGYLKAARAITAATGALLVLDEVQTGVGRTGHWFEYQAHEGVLPDVVTLAKGLGGGLPLGATVAFGRAADLLQPGHHGTTFGGNPVACAAGLAVLDTIADEGLLDNVKRQSETLRGGVEALGHPLVAHVRGAGLLLGIVLTEPLAAQVQQAAQDAGILVNAPAPDVVRLMPALNLGDDVVEAFLGALPGILDQAAETAHGDGRSGE
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
Q59928
|
MSNLFQNYTRADLEFIKAEGNYLFDTQGKKYLDFSTGIGVTNLGFHPQVQVALQKQAEQIWHTPNLYQNSLQEEVAAKLMAGKDYLAFFCNSGAEANEAAIKIARKATGKQEIITFQNSFHGRTFGSMSATGQDKIKVGFGDAVPHFHYAVFNDLNSVKALVTENTAAVMLELVQGESGVLPAEQDFVTALADYCQKNGLLLIIDEVQTGMGRTGKLYAFQHYGIEPDIFTLAKGLANGVPVGAMLAKKQFGSAFGPGSHGSTFGGNKLAMAASSAVLDIMTKAGFLEQAWENAHYLQEQLTSALQVADTVTQVRGLGYMIGIETTADLGQLVKATRDRGLIVLTAGTNVIRLLPPLTLTKDEIDQGIMILQEVFEQHN
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
P73133
|
MTYSPVVESVEAQAFAVTDLSPAAEFKTADFDTYVMNTYGRFPIAIARGQGSTLWDTEGKSYLDFVAGIATCTLGHAHPALVRAVSDQIQKLHHVSNLYYIPEQGELAKWIVEHSCADRVFFCNSGAEANEAAIKLVRKYAHTVLDFLEQPVILTAKASFHGRTLATITATGQPKYQQYFDPLVPGFDYVPYNDIRSLENKVADLDEGNSRVAAIFLEPLQGEGGVRPGDLAYFKRVREICDQNDILLVFDEVQVGVGRTGKLWGYEHLGVEPDIFTSAKGLAGGVPIGAMMCKKFCDVFEPGNHASTFGGNPLACAAGLAVLKTIEGDRLLDNVQARGEQLRSGLAEIKNQYPTLFTEVRGWGLINGLEISAESSLTSVEIVKAAMEQGLLLAPAGPKVLRFVPPLVVTEAEIAQAVEILRQAIATLV
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
Q9X2A5
|
MYLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARKYGKKKSEKKYRILSAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKMSEDVCAVFLEPIQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAKGLGGGVPIGAVIVNERANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVVADVRGMGLMIGIQFREEVSNREVATKCFENKLLVVPAGNNTIRFLPPLTVEYGEIDLAVETLKKVLQGI
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
P59322
|
MLAAPLPSFSTDAFDQVVMSTYGRFPITLVRGEGCRVWDDQGRSYLDFVAGIATCTLGHAHPALVETVSRQMQTLHHVSNLYYIPQQGALAQWLVAHSCGDRVFFCNSGAEANEAAIKLARKYAHTVRHIANPIIITAQASFHGRTLATITATGQPKYQKYFDPLVPGFAYVPYNDLGALEALVASLDQPQPQVAAILLEPLQGEGGVRPGDRAYFEQVRQLCTEKGILLIFDEVQVGMGRTGSLWGYETLGVEPDIFTSAKGLAGGVPIGAMIAKEFCAVFQPGDHASTFGGNPLATAAALTVCETLEKENLLENVRDRGQQLRTGLQELAAAYPQVIAEVRGWGLINGLELQPDTPLTAAEVVKAALAEGLLLVPAGPKVVRFVPPLIVSATEIDMALGAMSRALAHLAA
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
Q9KNW2
|
MTVEMSVDRSSFDEVMVPCYNPMEFIPVKGFGSRIWDQQGHEYIDFAGGIAVSCLGHCHPVMVQALTTQANKLWHLSNVMTNEPALRLAKKLTQVSFAEKVFFANSGAEANEAALKLARRYAADVYGPEKSEIIAFNQGFHGRTFFTVSVGGQATYSDGFGPKPGDIVHLPYNDLAALQAQISDRTCAVMMEPLQGEGGIVSPSAEFVQAVRELCDKHNALLIFDEVQTGNGRTGDFYAYQGIGVTPDILATAKSLGGGFPIGAMLTTAKIAEHMKVGVHGSTYGGNPLACAVAEAVVDFVAQPEILAGVKQREQWMRAELEKINQKYQLFKEIRGKGLLLGAALNDEWQGRARDILVAAGKQGLMVLVAGASVVRFTPSLIISQQEIEEGMARLDKAIATLM
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
Q87L20
|
MTTEIKVERGLFDEVMVPCYNPMEMIPVRGKGSRIWDQDDNEYIDFAGGIAVSCLGHCHPVMVDALTEQGNKLWHLSNVMTNEPALRLAKKLTEVSFAERVFFANSGAEANEAALKLARRYAADVHGPEKSEIIAFKQGFHGRTFFTVTVGGQAAYSDGFGPKPGDVTHLPYNDIEALQAHMSDRTCAVMMEPLQGEGGIVPPTPEFAQAVRELCDKHNALLIFDEVQTGNGRTGHFYAYQGLGITPDILSTAKSLGGGFPIGAMLTTAKLAEHLKVGTHGSTYGGNPLACAVAEAVVNEVTKPEVLAGVLEREALFRAGLEKINAKYNLFSEVRGKGLLLGAALNEEWQGRARDVLVAAGKQGLLVLVAGANVVRFTPSLVITQQEIEEGLAKLDKAIATLV
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
P59323
|
MTVEMKVERGLFDEVMVPCYNPMEMIPVKGQGSRIWDQNGNEYIDFAGGIAVSCLGHCHPVMVNALTEQAGKLWHLSNVMTNEPALRLAKKLTEVSFAERVFFANSGAEANEAALKLARRYAADVYGPEKSEIIAFKQGFHGRTFFTVTVGGQAAYSDGFGPKPGDVTHLPYNDIEALQAHISDRTCAVMMEPLQGEGGIIPPTAEFIQAVRELCDKHNALLVFDEVQTGNGRTGEFYAYQGLGVTPDILSTAKSLGGGFPIGAMLTTAKLAEHLKVGTHGSTYGGNPLACAVAEAVVTEVSKPETLQGVKEREQWFREGLAKLNEKYQIFAEIRGKGLLLGAALNEQWKGRARDVLVAAGKEGLLVLVAGANVVRFTPSLVITKQEIEEGFAKLDKAIASLV
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
Q7MH19
|
MTVEMKVERGLFDEVMVPCYNPMEMIPVKGQGSRIWDQNGNEYIDFAGGIAVSCLGHCHPVMVNALTEQAGKLWHLSNVMTNEPALRLAKKLTEVSFAERVFFANSGAEANEAALKLARRYAADVYGPEKSEIIAFKQGFHGRTFFTVTVGGQAAYSDGFGPKPGDVTHLPYNDIEALQAHISDRTCAVMMEPLQGEGGIIPPTAEFIQAVRELCDKHNALLVFDEVQTGNGRTGEFYAYQGLGVTPDILSTAKSLGGGFPIGAMLTTAKLAEHLKVGTHGSTYGGNPLACAVAEAVVTEVSKPETLQGVKEREQWFREGLAKLNEKYQIFAEIRGKGLLLGAALNEQWQGRARDVLVAAGKEGLLVLVAGANVVRFTPSLVITKQEIEEGFAKLDKAIASLV
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
Q7MAE6
|
MGEALDKEYVLHSYGRNYVQFTQGKNATLWDSEGKDYIDFASGIAVCSVGHGNERLAGAICDQAKKLIHTSNLYYIEPQARLAEKLVKLSGYDMRVFFANSGAEANEGAIKIARKFGESHEGEVKRYKIITLESSFHGRTITALKATGQEKMHHYFGPYPDGFVYAKNLDHVFKLVDEKTCAVLLELVQGEGGIEPQDREGIKKLERFLKERGVLLMVDEVQTGIYRSGELFASQAYGIVPDVITVAKGLAGGVPIGAVMTTLKDIFAPGDHGSTFGGNFLSTRAGLEVLSILESLYQEGTLQKSIDRFSAELRALCVEFPSLFECEVGLGLMRGIRAKSAEIQKSVIDEAFKKRVLVLRSGRNTVRFLPPLTLSEREMQEGFSRLREALKGI
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
Q8PH31
|
MSTAADSPLSLAHYYLPVYRPRQVVLERGQGSRVWDDAGREYLDLSSGIAVSGLGHNDPDLVAALTEQAGKLWHTSNVFFSAPPLKLAEELVSASRFAHKVFLCNSGTEANEAAIKLVRKWASSQGRPADKRVIVTFRGSFHGRTLASVTATAQPKYQEGYEPLPGGFRYVDFNDVAALEAAMAGGDVAAVMVEPIQGEGGVMPAAPGFLSRVRALCDQHDALLVLDEIQCGMGRTGTLFAHWQEQVTPDIVTLAKALGGGFPIGAMLAGPKVAQTMQFGAHGTTFGGNPLAAAVARVALRKLASPQIADNVVRQSAALRAGLEALNAEFGLFAQIRGRGLMLGAVLAPEHAGQAGAILDLAAKHGLLLLQAGPDVLRFVPALNLTDAELADGLARLRLATAEYVAQP
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
Q8P5Q4
|
MSTAADSPLSLAHYYLPVYRPRQVVLERGQGSRVWDDQGREYLDLSSGIAVSGLGHNDPDLMAALTEQAGKLWHTSNVFFSAPPLKLAEELVTASRFAQKVFLCNSGTEANEAAIKLVRKWASSQGRPADKRVIVTFRGSFHGRTLASVTATAQPKYQEGYEPLPGGFRYVDFNDVPALESAMASGDVAAVMLEPIQGEGGVMPAAPGFLARVRALCDQHDALLVLDEIQCGMGRTGSLFAHWQEQVTPDIVTLAKALGGGFPIGAMLAGPKVAETMQFGAHGTTFGGNPLAAAVARVALRKLASPQIAENVARQSAALRAGLEALNAEFGVFAQIRGRGLMLGAVLAPAHAGQAGAILDLAAAHGLLLLQAGPDVLRFVPALNLTDAELADGLARLRLAIAAYVAQH
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
Q9PDF2
|
MSAVSESVLSLSRYYLPVYRPCQVVLVRGQGSRVWDEQGRDYLDLAAGIAVCCLGHCDPDLVAALVEQAGRLWHTSNVFYSEPSLRLAQELVDVSRFAERVFLCSSGTEANEAAIKLVRKWAAAQGRLPEHRTIVTFHGSFHGRTLAAVTATAQPKYQEGYEPLPGGFRYVDFNHIEALEAAMVGGDVAAVMLEPIQGEGGVMPVVSGYLAQVRALCDRYGALLVLDEIQCGMGRTGTLFAYWQEEVVPDIVTLAKGLGGGFPIGAMLAGPKVAEVMQFGAHGTTFGGNPMAAAVARVALRKLASVEIAANVQRQSVALRAGLEEISEAFGGVFTQVRGRGLMLGAVLAPLYAGQASAILEVAVEHGVLLLQAGPDVLRFVPALNVSDEELADGLVRLRAALGDYVSRFGG
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
Q87DM8
|
MSAVSESVLSLSRYYLPVYRPCQVVLVRGQGSRVWDEQGRDYLDLAAGIAVCCLGHCDPDLVAALVEQAGRLWHTSNVFYSEPSLRLAQELVDVSRFAERVFLCSSGTEANEAAIKLVRKWAAAQGRLPEHRTIVTFRGSFHGRTLGAVTATAQPKYQEGYEPLPGGFRYVDFNHIEALEAAMVGGDVAAVMLEPIQGEGGVMPIAPGYLAQVRALCDRYGALLVLDEIQCGMGRTGTLFAYWQEEVVPDIVTLAKGLGGGFPIGAMLAGPKVAEVMQFGAHGTTFGGNPMAAAVARVALRKLASVEIAANVQRQSVALRAGLEEISEAFGGVFTQVRGRGLMLGAVLAPLYAGQASAILEVAAEHGVLLLQAGPDVLRFVPALNVSDEELADGLVRLRAALGDYVSRCRG
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Homodimer. May also have succinyldiaminopimelate aminotransferase activity, thus carrying out the corresponding step in lysine biosynthesis. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
|
Q6C846
|
MNRFSKIRQYSTLLQTAEKYSVPTYAKPSVILTKGKGAYLWDSNDNKYIDFSAGIAVTALGHSNPEITKILAEQSSQLMHCSNLFNNEWAPRLQESLVEETLKSGGMKGARKVFLANSGTEANEAALKFARKVGTLSSPDKTEFVNFEKAFHGRTMGALSVTPNPKYQAPFAPLVPGVKTGVYNDPKAADLITEKTCGVIVEPVQGEGGVYKANDEFLQALRNKCDEVGAMLIFDEIQCGLGRTGRLWAHDKVHPDILTMAKALGNGFPIGATMVTEAVADKIAIGDHGTTYGGNPLASRVGHYVLSQVASKEVLDNVKKVSQQIRDAVAEVQEEFPELITEVRGDGLLLGIQFSKDPSKVVAAARENGLLVITAGTNTVRLVPALNIDQEAVTEGLEILKKAIRDNAKDL
|
2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.
|
D6W1S9
|
MFKRYLSSTSSRRFTSILEEKAFQVTTYSRPEDLCITRGKNAKLYDDVNGKEYIDFTAGIAVTALGHANPKVAEILHHQANKLVHSSNLYFTKECLDLSEKIVEKTKQFGGQHDASRVFLCNSGTEANEAALKFAKKHGIMKNPSKQGIVAFENSFHGRTMGALSVTWNSKYRTPFGDLVPHVSFLNLNDEMTKLQSYIETKKDEIAGLIVEPIQGEGGVFPVEVEKLTGLKKICQDNDVIVIHDEIQCGLGRSGKLWAHAYLPSEAHPDIFTSAKALGNGFPIAATIVNEKVNNALRVGDHGTTYGGNPLACSVSNYVLDTIADEAFLKQVSKKSDILQKRLREIQAKYPNQIKTIRGKGLMLGAEFVEPPTEVIKKARELGLLIITAGKSTVRFVPALTIEDELIEEGMDAFEKAIEAVYA
|
catalyzes the conversion of N-acetylglutamate-gamma-semialdehyde (NAGSA) to N-acetylornithine in arginine biosynthesis. 2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. The reaction catalyzed by ACOAT is highly reversible. Moreover this enzyme may transaminate ornithine, although this activity should be of little importance at physiological pH. Present with 2300 molecules/cell in log phase SD medium. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.
|
P59324
|
MTDKLAVNRNTFDQVILPVYAPAQFIPVKGKGSRVWDQQGTEYIDFAGGIAVTALGHCHPALVSALHQQGETLWHTSNVFTNEPALRLAQKLIAATFADRVFFANSGAEANEAAFKLARHYAIERHSPYKTKIIAFHNAFHGRTLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITSATPEFLQGVRALCDQHNALLVFDEVQSGMGRSGKLFSYMHYGVTPDILTTAKALGGGFPISAMLTTEEIASVMTVGTHGTTYGGNPLACAVAEAALDVINTPEVLNGIEQRHGLFVQALQSINSKYDVFSDIRGMGLLIGAELTAKYRGQAREFLAAAAANGLMILNAGPDVLRLAPSLVIELEDIQQGMARLEKAMASVIKG
|
Involved in both the arginine and lysine biosynthetic pathways. 2-oxoglutarate + N(2)-acetyl-L-ornithine = L-glutamate + N-acetyl-L-glutamate 5-semialdehyde 2-oxoglutarate + N-succinyl-(2S,6S)-2,6-diaminoheptanedioate = (S)-2-succinylamino-6-oxoheptanedioate + L-glutamate Binds 1 pyridoxal phosphate per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 4/4. Amino-acid biosynthesis; L-lysine biosynthesis via DAP pathway; LL-2,6-diaminopimelate from (S)-tetrahydrodipicolinate (succinylase route): step 2/3. Homodimer. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily. PubMed:11586360 sequence differs from that shown due to the presence of an IS100 insertion element between positions 182 and 183. This gene in strain CO-92 may, therefore, be a pseudogene.
|
Q5E2E4
|
MKFPEFKDYYQQLISTSSISSTDSSWDEGNAEVINKLAQWCEDLGCEVEIEEIEKGKLNLLAKLGSGEGGLLLAGHTDTVPYDEGRWNYEPHALTEANDRFYGLGTADMKGFFAFILEAIKNINWKDQSKPLYILATCDEETTMLGARHFASNTKIQPDYCIIGEPTSLKPIRGHKGHVANAIRVTGKSGHSSDPAHGVNALEIMNEIMFALMTLKNKLVKEYHNPGFSIPYPTLNLGHIHGGDSPNRICGCCELHYDVRPLPGISLDGLDNMLRDALKEIEAKWPGRIDITPLHEPIPGYECSADSPIVTSTADICGQDVETVNYCTEAPFLQDLCPTLVLGPGSIEQAHQPDEYLAFSFIDPTISILSKLMYKHCF
|
Catalyzes the hydrolysis of the amide bond of N(2)-acetylated L-amino acids. Cleaves the acetyl group from N-acetyl-L-ornithine to form L-ornithine, an intermediate in L-arginine biosynthesis pathway, and a branchpoint in the synthesis of polyamines. H2O + N(2)-acetyl-L-ornithine = acetate + L-ornithine Binds 2 Zn(2+) or Co(2+) ions per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine from N(2)-acetyl-L-ornithine (linear): step 1/1. Homodimer. Belongs to the peptidase M20A family. ArgE subfamily.
|
B5FBP7
|
MKFPEFKDYYQQLISTSSISSTDSSWDEGNAEVINKLAQWCEDLGCEVEIEEIEKGKLNLLAKLGSGEGGLLLAGHTDTVPYDEGRWNYEPHALTEANDRFYGLGTADMKGFFAFILEAIKNINWKDQSKPLYILATCDEETTMLGARHFASNTKIQPDYCIIGEPTSLKPIRGHKGHVANAIRVTGKSGHSSDPAHGVNALEIMNEIMFALMTLKNKLVKEYHNPGFSIPYPTLNLGHIHGGDSPNRICGCCELHYDVRPLPGISLDGLDNMLRDALKEVEAKWPGRIDITPLHEPIPGYECSADSPIVTSTADICGQDVETVNYCTEAPFLQDLCPTLVLGPGSIEQAHQPDEYLAFSFIDPTISVLSKLMYKHCF
|
Catalyzes the hydrolysis of the amide bond of N(2)-acetylated L-amino acids. Cleaves the acetyl group from N-acetyl-L-ornithine to form L-ornithine, an intermediate in L-arginine biosynthesis pathway, and a branchpoint in the synthesis of polyamines. H2O + N(2)-acetyl-L-ornithine = acetate + L-ornithine Binds 2 Zn(2+) or Co(2+) ions per subunit. Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine from N(2)-acetyl-L-ornithine (linear): step 1/1. Homodimer. Belongs to the peptidase M20A family. ArgE subfamily.
|
Q7WF54
|
MAVNLQIPSESEILPVAGVEIGVAEAGIRKAGRRDLTVFRLAPGSAVAGVFTRNRFRAAPVQVCEAHLAQGGPIRALVVNTGNANAGTGAPGLKNAQDTCAALGKLLDVPAEQILPFSTGVILEPLPMDRLTAGLPAAVADLRADGWYGAAHGIMTTDTLPKIHSRRVDIGGKTVTITGISKGAGMIRPNMATMLGFLATDAGIAQPLLRQLAIELADVSFNRITVDGDTSTNDSFILIATGQAGVTVDSAGDAAYAALRDALAAAATDLAQKIVRDAEGATKFMTIRVEEAGNTEEALKVAYAVAHSPLVKTAFFASDPNLGRILAAIGYAGIDDLDVSRLRLWLGDVLVAVDGGRNPDYQEADGQRVMKQAEILVRIALGRGQVADTVYTCDFSHEYVTINADYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q7W3S6
|
MAVNLQIPSESEILPVAGVEIGVAEAGIRKAGRRDLTVFRLAPGSAVAGVFTRNRFRAAPVQVCEAHLAQGGPIRALVVNTGNANAGTGAPGLKNAQDTCAALGKLLDVPAEQILPFSTGVILEPLPMDRLTAGLPAAVADLRADGWYGAAHGIMTTDTLPKIHSRRVDIGGKTVTITGISKGAGMIRPNMATMLGFLATDAGIAQPLLRQLAIELADVSFNRITVDGDTSTNDSFILIATGQAGVTVDSAGDAAYAALRDALAAAATDLAQKIVRDAEGATKFMTIRVEEAGNTEEALKVAYAVAHSPLVKTAFFASDPNLGRILAAIGYAGIDDLDVSRLRLWLGDVLVAVDGGRNPDYQEADGQRVMKQAEILVRIALGRGQVADTVYTCDFSHEYVTINADYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q7VSW3
|
MAVNLQIPSESEILPVAGVEIGVAEAGIRKAGRRDLTVFRLAPGSAVAGVFTRNRFRAAPVQVCEAHLAQGGPIRALVVNTGNANAGTGAPGLKNAQDTCAALGKLLDVPAEQILPFSTGVILEPLPMDRLTAGLPAAVADLRADGWYGAAHGIMTTDTLPKIHSRRVNIGGKTVTITGISKGAGMIRPNMATMLGFLATDAGIAQPLLRQLAIELADVSFNRITVDGDTSTNDSFILIATGQAGVTVDSAGDAAYAALRDALAAAATDLAQKIVRDAEGATKFMTIRVEEAGNTEEALKVAYAVAHSPLVKTAFFASDPNLGRILAAIGYAGIDDLDVSRLRLWLGDVLVAVDGGRNPDYQEADGQRVMKQAEILVRIALGRGQVADTVYTCDFSHEYVTINADYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
P59610
|
MSSSVSPLAPKTVPDMPVIAGVRLATAEAGIRYKNRTDVLLAVMDKGTAVAGVFTKSKCPSAPVEWCRAKLKGGKARALVVNSGNANAFTGKTGRSSTALTAKIAAKAVGCSESEIFLASTGVIGEPLDATKFDGVLGRLAETAEPGDYLAAAKAIMTTDTFPKVATATVKLGKAKVTINGMAKGAGMIAPDMATMLSFVFTDAPIAPAALQALLKSGVEDTFNAVTIDGDTSTSDTLLAFATGAAAEHGAPKISRASDPRLKAFVKAFNQVLANLAEQVARDGEGARKLVEITVEGAKTKASARKIAMSIANSPLVKTAIAGEDANWGRVVMAVGKAGEPADRDKLSISFNGIRVARSGARDPDYDEAQVSEAMKAPEIAIKVSLGLGKGRDRVMTCDLTKEYVAINGDYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q57AV8
|
MSASVSPLAPKHYPAMPVIHGVRIATAAAGIKYKGRTDLMLMVFDRPAEAAGVFTRSLCPSAPVDFCRRNLVHGKARAVVVNSGNANAFTGLKGREATQATAEAAAKAIGCATTDIFLASTGVIGEPLDAGKFSHLLGDMAESATEDFWTEAAKAIMTTDTYPKVATETVLLGQVPVTINGIAKGAGMIAPDMATMLSFVVTDAPIKADALQSLLSKGVGSTFNSVTVDSDTSTSDTLMLFATGTAAERGAPEITDAADKRLADFKKALGRVLKSLALQVVRDGEGARKMVEVEVTGAKSAASAKKIALSIANSPLVKTAVAGEDANWGRVVMAVGKAGEPADRDRLAIWFGDIRVAHQGERDPAYSEDATSAYMEGEDIRIRVDLGIGRGKATVWTCDLTKEYVAINGDYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q8YJF9
|
MSASVSPLAPKYYPAMPVIHGVRIATAAAGIKYKGRTDLMLMVFDRPAEAAGVFTRSLCPSAPVDFCRRNLVHGKARAVVVNSGNANAFTGLKGREATQATAEAAAKAIGCATTDIFLASTGVIGEPLDAGKFSHLLGDMAESATEDFWTEAAKAIMTTDTYPKVATETVLLGQVPVTINGIAKGAGMIAPDMATMLSFVVTDAPIKADALQSLLSKGVGSTFNSVTVDSDTSTSDTLMLFATGTAAERGAPEITDAADKRLADFKKALGRVLKSLALQVVRDGEGARKMVEVEVTGAKSAASAKKIALSIANSPLVKTAVAGEDANWGRVVMAVGKAGEPADRDRLAIWFGDIRVAHQGERDPAYSEDATSAYMEGEDIRIRVDLSIGRGKATVWTCDLTKEYVAINGDYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
G0K884
|
MSASVSPLAPKHYPAMPVIHGVRIATAAAGIKYKGRTDLMLMVFDRPAEAAGVFTRSLCPSAPVDFCRRNLVHGKARAVVVNSGNANAFTGLKGREATQATAEAAAKAIGCATTDIFLASTGVIGEPLDAGKFSHLLGDMAESATEDFWTEAAKAIMTTDTYPKVATETVLLGQVPVTINGIAKGAGMIAPDMATMLSFVVTDAPIKADALQSLLSKGVGSTFNSVTVDSDTSTSDTLMLFATGTAAERGAPEITDAADKRLADFKKALGRVLKSLALQVVRDGEGARKMVEVEVTGAKSAASAKKIALSIANSPLVKTAVAGEDANWGRVVMAVGKAGEPADRDRLAIWFGDIRVAHQGERDPAYSEDATSAYMEGEDIRIRVDLGIGRGKATVWTCDLTKEYVAINGDYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q39JW0
|
MAVNFPSIDPAQLHPVAGVTLGWAEANIRKPNRKDVLVISVDESATVAGVFTENRFCAAPVIVCREHLAKVRAGGAGIRALVVNTGNANAGTGEPGLVNARETCAELARLAGIEPAQVLPFSTGVILEPLPIDRLKAGLPAALANRKAANWFDAAQAIMTTDTLPKATSRQVTIDGHTVTLTGISKGAGMIKPNMATMLGFLAFDANVAQPVLDTLVKEVADRSFNCITIDGDTSTNDSFILIASGKSTLPAITSTDSPAYAALRDAVTEVAQVLSQLIVRDGEGATKFMTVQVEGGKSVAECRQIAYAIGHSPLVKTAFYASDPNLGRILAAIGYAGVADLDVDKIDLYLDDVLVAKAGGRNPAYQEEDGQRVMKQSEITIRVQLGRGDAQATIWTCDLSHDYVSINADYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q62GT9
|
MAVNFPSIDPAQLHPVAGVTLGWAEANIRKPNRKDVLVVSVEEGATVSGVFTENRFCAAPVTVCREHLAKVRAGGAGIRALVVNTGNANAGTGEPGLAHARETCAELARLAGIAPGQVLPFSTGVILEPLPIERLKAGLPAALANRAAANWHDAAQAIMTTDTLPKAASRQVMIDGHTITLTGISKGAGMIKPNMATMLGFLAFDAKVAQPVLDALVKDVADRSFNCITIDGDTSTNDSFILIASGKASLPQIASTDSPAYAALREAVTSVAQALAQLIVRDGEGATKFITVTVEGGKSAAECRQIAYAIGHSPLVKTAFYASDPNLGRILAAIGYAGVADLDVGKIDLYLDDVLVAKAGGRNPAYLEEDGQRVMKQSEIAVRVLLGRGDAQATIWTCDLSHDYVSINADYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q3JNE9
|
MAVNFPSIDPAQLHPVAGVTLGWAEANIRKPNRKDVLVVSVEEGATVSGVFTENRFCAAPVTVCREHLAKVRAGGAGIRALVVNTGNANAGTGEPGLAHARETCAELARLAGIAPGQVLPFSTGVILEPLPIERLKAGLPAALANRAAANWHDAAQAIMTTDTLPKAASRQVTIDGHTITLTGISKGAGMIKPNMATMLGFLAFDAKVAQPVLDALVKDVADRSFNCITIDGDTSTNDSFILIASGKASLPQIASTDSPAYAALREAVTAVAQALAQLIVRDGEGATKFITVTVEGGKSAAECRQIAYAIGHSPLVKTAFYASDPNLGRILAAIGYAGVADLDVGKIDLYLDDVLVAKAGGRNPAYLEEDGQRVMKQSEIAVRVLLGRGDAQATIWTCDLSHDYVSINADYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q63QK7
|
MAVNFPSIDPAQLHPVAGVTLGWAEANIRKPNRKDVLVVSVEEGATVSGVFTENRFCAAPVTVCREHLAKVRAGGAGIRALVVNTGNANAGTGEPGLAHARETCAELARLAGIAPGQVLPFSTGVILEPLPIERLKAGLPAALANRAAANWHDAAQAIMTTDTLPKAASRQVTIDGHTITLTGISKGAGMIKPNMATMLGFLAFDAKVAQPVLDALAKDVADHSFNCITIDGDTSTNDSFILIASGKASLPQIASTDSPAYAALREAVTAVAQALAQLIVRDGEGATKFITVTVEGGKSAAECRQIAYAIGHSPLVKTAFYASDPNLGRILAAIGYAGVADLDVGKIDLYLDDVLVAKAGGRNPAYLEEDGQRVMKQSEIAVRVLLGRGDAQATIWTCDLSHDYVSINADYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q8R7B9
|
MEILDGKIELPKGFVASGVFAGIKRSKKDLALIYSERLANISAVFTTNRVKAAPVILDMERAKKGKAQAIVINSGNANACTGEKGIEDAKSMAKKVAEVLEIEEEDVLVCSTGVIGVPLPMEKVLKGIEVAALSLSKEGGYDAAHAIMTTDTFLKAVTVKFNVEGKDITMTGFAKGSGMIHPNMATMLSFVLTDASVEKATLDKAFKNTVNRTYNMISVDGDMSTNDTAIVMANGMAENKAIQEGTYEFDLFYKALEYVNKTLARLIAKDGEGATKLIEVNVINAKTENDARLAAKAIVNSNLVKTAIFGEDANWGRILAAVGYSGADFDVDKVDIYLKSAKGEVKVCENGSFFAFDESLAKEVLKEKEIFIIVDMKAGEFMATSWGCDLSYDYVKINGSYRT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q3MPC8
|
MHKVTKFAIRHLSDKASRFVPKAGVYPKGYAVGGIHCGVKKDGKSLDLAILQNTFGKNASAAGVFTVNKFKAAPVQVSKKILKEKSGSGINSFVINSGNANAVTGTQGMKDAEDMVLVTDSVLENPTNSSLVMSTGVIGNNLPIDKILGGIPKLASQHLGNTHQHWIDCATAICTTDTFPKLVTKRFSIGDDTYTLAGLCKGAGMICPNMATLLGFFVTDAPVTPSALQQILKYAVDRSFNSITVDGDMSTNDTIVAMANGAAGGEVIDNTSSCAERYSRLQAEIVDFAQQLAQLVVRDGEGATKFITIRVKDALSYKDAKSIASSIANSSLFKTAMYGKDANWGRILCAIGYADVTSANSVIPEKTSVKFVPVDGSEHLNLLVNGEPEQVDEERASEILQNEDLIVEINLGTNGGQSADFWTCDLSHEYVTINGDYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
C4YTS0
|
MHKVTKFAIRHLSDKASRFVPKAGVYPKGYAVGGIHCGVKKDGKSLDLAILQNTFGKNASAAGVFTVNKFKAAPVQVSKKILKEKSGSGINSFVINSGNANAVTGAQGMKDAEDMVLVTDSVLENPTNSSLVMSTGVIGNNLPIDKILGGIPKLASQHLGNTHQHWIDCATAICTTDTFPKLVTKRFSIGDDTYTLAGLCKGAGMICPNMATLLGFFVTDAPVTPSALQQILKYAVDRSFNSITVDGDMSTNDTIVAMANGAAGGEVIDNTSSCAERYSRLQAEIVDFAQQLAQLVVRDGEGATKFITIRVKDALSYKDAKSIASSIANSSLFKTAMYGKDANWGRILCAIGYADVTSANSVIPEKTSVKFVPVDGSEHLNLLVNGEPEQVDEERASEILQNEDLIVEINLGTNGGQSADFWTCDLSHEYVTINGDYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
B9WK98
|
MHKVTKFAIRHLSDKASRFVPKAGVYPKGYAVGGIHCGVKKDGKSLDLAILQNTFGKNASAAGVFTVNKFKAAPVQVSKKILKEKSGLGINSFVINSGNANAVTGTQGMRDAEDMVLVTDSVLDNPTNSSLVMSTGVIGNNLPIDKILGGIPKLASQHLGNTHQHWIDCATAICTTDTFPKLVTKRFSIGDDTYTLAGLCKGAGMICPNMATLLGFFVTDAPVTPSALQQILKYAVDRSFNSISVDGDMSTNDTIVAMANGAAGGEVIDNTSSCAERYSRLQTEIVGFAQQLAQLVVRDGEGATKFITIRVKDALSYKDAKSIASSIANSSLFKTAMYGKDANWGRILCAIGYANVTSANSVIPEKTSVKFVPVDGSDHLNLLVNGEPEQVDEERASEILQNEDLIVEVNLGTNGGQNADFWTCDLSHEYVTINGDYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
Q6FU44
|
MKISKTLLQHGRKVIDKYNLYVPTEGVFPKGYKVGSIASGVKKNGNLDLGVLVNTNTSRPSSAAAVFTTNKFKAAPVLTSKKVLESTQGNGINAIVVNSGCANAVTGELGMQDAQEMIDLVNRKIGKPNSTLVMSTGVIGQRLQMDKISAGIKNIFDNNALGNDFKSWLNIAKSINTTDTFPKLVSRQFELLNGQKYTLVGMAKGAGMICPNMATLLGYFVTDLPIASSALQKILRFATDRSFNCISVDGDMSTNDTICMIANGAVETDEITESSEEYEQVKSQVTEFAKTLAQLVVRDGEGSTKFVTVNVQNSLTFEDAKIIAESISNSMLVKTALYGQDANWGRILCAIGYAKLDNLKSLNTDSISVSFIATDNSEPRELKLVENGVPQLDVDEERAAQILALDDLEVLVDLKTGNESAQFWTCDLSHEYVTINGDYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
C5MG55
|
MSISKYSIRFLSDKATRFVPKSGVYPKGYAVGGIHCGVKKDGKSLDLAILQNTFNKEASTAGVFTQNKFKAAPVQVSMRILKQKSGSGINSFVINSGNANAVTGSKGMKDAEEMVTVTDSVLENPKDSTLVMSTGVIGNNLPIDNILTGIPKLSLNHLGNTHQHWIDCATAICTTDTFPKLVTKQFNLGNDTYTLAGLCKGAGMICPNMATLLGFFVTDAPVSPNALQQILRYAVDRSFNSITVDGDMSTNDTIVAMANGAAGGELIDNTSSSAERFSALQTEIVDFAQQLAQLVVRDGEGATKFITLKVNDALSYKDAKSIASSIANSSLFKTAMYGKDANWGRILCAIGYADVSTDQSVIPNKTSVKFVPVDGSEPIKIIWLMVNSKKLTKIELQKYYKMKIW
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
Q3A9W1
|
MKKIQGGVTAPEGFLAAGVHAGIKKSKKDVAVIFSEKPAVGAAVFTTNKVKAAPILLSMENIKDQLISAIVVNSGNANACTGEEGMLAARQMLDETGKCLGIPISQILVASTGVIGVPLPVNKVLNGIRMACQALSREGSGAAAEAIMTTDTVPKEIAVEFEVYGKTVKVGGIAKGSGMIHPNMATMLAFITTDIGMEKELLQETLREVVDESFNMISVDGDSSTNDMVAVLANGLSGVWVESKEEEAYLKFKNALEYVAICLAKAIARDGEGATRLIEVRVVNAESLQKARKIARTVTSSNLFKAAVFGEDANWGRIITAVGYAGEEITVEKIDIYLGKVKVLQKGVPLPFSEEEAKEELAREEVIVTIDLNEGDANAVAWGCDLTYDYVKINASYRT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q9A3Y4
|
MPFPTIPPIAGVEIATGRAGFYKHEREDLLLMRFAEGTSAAGVFTRHGVGSAPVDWCKRQLAATGGADVRALVVNAGCANSFTGKPGADAVRRVATAVGKRFDCRQRDVMMASTGVIGVILDDSKITARLPEVESRLKADAWAEAGRAIMTTDTFPKGAYATAVIDGHEVKIAGIAKGSGMIAPDMATMLAFVATDAAIAPAALQTLVSLYTRTTFNCVTVDGDRSTNDTLLLFATGQSGAPKIHRAGDKRLADFREKLEGVLLDLALQLVKDGEGATKFVKITVNGAESPASARKIARTIAESPLVKTAFAGEDANWGRIVMAVGRADEPVAREKISVKFGDLYAARDGLISAEYDEAKMSAYVKNQAFEVSVDVGVGRGSATVWTCDLTKQYVAINGDYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q2HAX7
|
MAMAGCNGFFLHQLRQPRLQLARQLGRTPSRAYSAPSNGSIPAAKKKYVPTKGTYPLGFRTSGTIVGVKPSNTTKPDLALLTSDAPCVAAAVFTKNKFQAAPVTFSRNLLERRKNQGIQSVIINSGCANAVTGKGGLEDATKMAQEADKCTGQNESTIVMSTGVIGQRLPIDKILNKVPSAHGALGGSHDHWLAAAKAICTTDTFPKLMSRTFALPSSPGVEYRIAGMTKGAGMIHPNMATLLGVIATDAPITSAALPSALKHAVDRSFNSITIDGDTSTNDTVALFANGAAGGKEVAEGTPDYDAFRAVLTDFAAELAQLVVRDGEGATKFVTVRVTESASEEAARRIASTIARSPLVKTALYGKDANWGRILCATGYSLISEPGQPINDVPEIAPEKTNVSFIPTDGTAELKLLVNGEPEKVDEARAAEILELEDLEILVRLGQGDKQATYWTCDYSHEYITINGDYRT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. Belongs to the ArgJ family.
|
Q7U3S6
|
MVPVSLGCAMQSPWQLVSGGVTSPQGFQASGIAAGLKPSGKLDMALLLAPEQAVCAGSFTTSVVRAACVDLCAERLAANGGQARAVLINSGQANACTGDRGLIDSQRATQALADQLGLDAEALLICSTGVIGVPIPMPKLLAGLDPLVAALSATGGEAAATAILTTDLVSKQVALEAELGGRRVRIGGIAKGSGMIHPDMATMLGFFSCDAGLDPSIWKAMVGQAVQRSFNAITVDGDTSTNDTVLAFAAGDPLDSVHHAALEQGLTEAMQHLAKAIARDGEGATCLIEVQVEGALDEPSAQRVARTIVGSSLVKTAVHGRDPNWGRIVAAAGRSGVPFDPEQVALWIGPHQLMQSGQPLSFDPEAASRVLRSETVQIRIQLGDGPGNGLAWGCDLSDQYVRINADYTT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
B6HQD4
|
MATSLARMLKGQVRCYSAPLDMAIPASKQRYIPTTGTYPQGFQVSGTHVGVKASNTRFPDLALIASDTPCSAAAVFTTNKFQAAPVQVSRKTLQSRKGDGIRAVVINSGCANAVTGKGGLEDAVQMGRKVDECSGVENDSSLVMSTGVIGQRLPISKILDRIPTAHSTLASTHEAWLNTARAICTTDTFPKLLSRTFTLPSSPDRSYRLAGMTKGAGMIHPNMATLLGVLCTDAAVEPAALQSILKHAVSRSFNSISIDGDTSTNDTIAVLANGAAGGETVRAPGASASADYTALQGVVTDFAQELSQLVVRDGEGATKFVTVRVRNSPDYESGRMIASTIARSPLVKTALYGKDANWGRILCAVGYTQGVAEGTVVPERTSVSFRPVDGSEVLKLLVNGEPETVDEQRASVILQNEDLEIEVDLGGGEQGAAGCGGEDAVYWFCDFSHECIPAFAVDIIESREISGLKAFGSENAYIYEEEPLK
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
D0N1U4
|
MSFLRLSSLSRSRSLLQTRCLSTHGHPFVFDSRHEYMDYLEAHQSRLPWGFSVATTKFDFVPQEAPHLPAKMTMTLIKPVKPTSLFAAVFTQNAFPGAPVLVGRKRLNEPKLGAILVNSKISNVCASGGGVADAEEVCENLAKHLRLEGGSQVLPCSTGVIGWRIPVDSMVENLPKLVTNLQSESVLPAAEGIMTTDLYPKIRSMDVCGGRIVGIAKGAGMIEPNMATMLSYILTDLSIPRDVLRQLLTEVVGDTYNSLSVDTDQSTSDTVTLVSSDQIPFDMKQLDEFKTALHEVCLGLSEDIVRNGEGAHHVMRVRVSGALSNEMAKGVGKSVVNSPLLKCAVAGNDPNVGRLVMAVGKYMGTYHKDVNIQRRMKIRMGGVVIFENGEMVLNDDIEAKLVAHMRDAMLIEPTRGGLDASSHNYPPHGKFVEIEIDLGVGSKETQVLGIDLTHEYVAINADYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
A9SLE5
|
MAMVSSCRLCLRTDSLYLAIEQSAAQANSLPRSSCSVVPRRTQIICPQLQVLPNALKSLQPGHGLKRLKEGNVFAVRASTTTDTDVNVDADAVAPGKFIPASPIVLSKGPWEQIPGGVTAAKGFRAAGMYAQLRAAGKKPDLALIVCDTDAVSAGTFTKNVVAAAPVIYCKKTLADSSTARAILINAGQANAATGDAGYQDTLECVAAVAKHCGVPEGAVLIESTGVIGRRIKKDALIEAVPKLVGSLSASVASADAAAVAITTTDLVSKSVAIETKIGGTTVRLGGIAKGSGMIHPNMATMLGVVTCDVDVTAEVWRPMVITAVNRSFNQITVDGDSSTNDTLLALASGAAGGPKISDINSEEARQLQAALDAVLQGLAKSIASDGEGATCLVEVTVTGASDEAAAATVARSVAASSLTKAAIYGRDPNWGRIACATGYAGVPFDPLCLQIYLGDFHLMEKGQPLEFDSNGASAYLKKAGEVHGTVSINICIGHGPGQSQAWGCDLSYDYVKINAEYTT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
A5DAF0
|
MVVNKGIRLLSTKAARFVPSGGVYPKGFVVGGIHCGVKKDGKSPDLAVLHNTFGQDANAAAVFTKNKFKAAPVQVSAATIKQKNGVGINSIIVNSGNANAVTGQKGMEDARAMAMVTDSVFGDHKDSTLVMSTGVIGNKLPIDNILSGIPKLESQVGDSHDHWLACANAICTTDTFPKLVSKSFEINGNTYTMAGVAKGAGMICPNMATLLGFFVTDAPVSAKALQQILSYATDRSFNSISVDGDMSTNDTIVAIANGAAGGDLIDNNSSCAESYFELQKEVTSFAQKLAQLVVRDGEGATKFITLKVKDALSYKDAKSIASSIANSSLFKTAMFGKDANWGRILCAIGYSDVSTAQSIIPDRTSVTFVPTDGSEPLPLLVDGEPESVDEARAAQILELEDLEIEIDLGTGGGQEAKFWTCDLSHEYVTINGDYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
A3LWC0
|
MRSVSITRTSVRFVSDKASRFVPKSGVYPQGFSVGGIHCGIKKDGKSLDLALLRNDFGKDASAAAVFTTNKFKAAPVQVSSKLIKEKKGVGINSIIINSGNANAVTGAQGMKDAEDMILVTDSVLENPVNSTLVMSTGVIGNNLPIDNILSGIPKLALNNLGSTHEHWLTCATAICTTDTFPKLVSKQFELNGHTYTLAGLAKGAGMICPNMATLLGFFVTDAPVTPSALGQILKYSVERSFNSISVDGDTSTNDTIIAIANGAAGGPVIDNNSSTAESFAVVQKEITGFAQQLAQLVVRDGEGATKFINIHVKDALSYKDAKIVASSVANSSLFKTAMFGQDANWGRILCAIGYSKVSTADSIVPTKTSVSFVPTDGSEELKLLINGEPEVVDEERASEILKSEDLDIVIDLGTGGGQSANFWTCDLTHEYVTINGDYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
A0A090CCE3
|
MVGFSRCALSQLRQPKAQLVRSFSHIPSRAYSAPSSSIPAAKKKYIPTSGTYPLGFQVSGTIVGVKPSNTTKPDLALLTSEVPCAAAAVFTKNKFQAAPVTFSRALLQKKGNKGIQGVVINSGCANAVTGKGGLEDAAKMAQAADKCLGQSDSIIVMSTGVIGQRLPIDKIINNVPKAHSALGGSHEHWLTMAKAICTTDTFPKLISRTFTLPSSPGVEYRIAGTTKGAGMIHPNMATLLGVIATDAPISSSALPSVLKHAVDRSFNSITIDGDTSTNDTVALLANGMAGGKEVVEGTPDYEAFREVLTKFSTELAQLIVRDGEGATKFVTIKVVDSASEEAARKIASTIARSPLVKTALYGKDANWGRILCATGYSLISEPSEPINDVPEIVPENTNVSFVPTDGTAELKLLVNGEPEQVDEARAAEILELEDLEILVRLGTGDKQATYWTCDYSHEYITINGDYRT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. Belongs to the ArgJ family.
|
D3AXF4
|
MYKSITTLLKQQPQSILRNYSTDKFPRGFKTGTAACGLKKTGNKDICIIHSSAPCNVAAVFTENKVKAAPVLLSKQLLETNNYKGFNSLVINSGGANACTGEQGLKNAKTMSNLTSSLLKAPQASLVMSTGIIGQQLDMSKVEKGIADAVTTLNESDWISAARAIMTTDKVPKLAQKSVSLNGGEVHIVGICKGAGMIHPNMATMLCTVCTDASISEDCLRALLKHSVHYSFNSINVDGDMSTNDTVAIFANGSAGNKHITDTTSSDFLQLQEAVREVTTRLAQMIVRDAEGASKFVTIKIHGADTEQNGHIVANSISTSSLVKSALYGEDANWGRVLAAVGYSGVDIDPLKVCMWFAKGDGKDVGLGKKNDPETSMQFLEKGTPLAKDENKAAQLLSNNDVAIVVELGMGKASSTMWTCDLTEEYVRANSHYRT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
U5FU53
|
MHTCAPPHHFSSLKFPELHGSSKLNNLQVLRSFGLSKRSFKVFAVAASSSSSMSEASNYIPAAPIFLPEGPWQQIPGGVTAAKGFKAAGIYGGLRAKGEKPDLALVTCDVDATAAGAFTTNMVAAAPVLYCKNALDISKTARAVLINAGQANAATGDAGYQDVLESVGALAMLLKLKPEEVLIESTGIIGQRIKKGALLNSLPKLVNSLSPSIEGAGSAAVAITTTDLVSKSVAIESQVGGTNIKVGGMAKGSGMIHPNMATMLGVITTDALVNSDVWRKMVQISVNRSFNQITVDGDTSTNDTVIALASGLSGSISISNINCHEAMQLQACLDAVMQGLAKSIAWDGEGATCLIEVTVTGAESEAKAAKIARAVASSSLVKAAVYGRDPNWGRIAAAAGYAGIPFHQNNLRIMLGDILLMDNGQPLSFDRSAASNYLRKAGEIHGTVGIYISVGDGPGSGQAWGCDLSYDYVKINAEYTT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
B8PH83
|
MSARLPALWKRLSSTISPRPAPPKAHHHAPIREAAFPNGYVLTGLHCGIKKTGALDLAVILSTTPKPASAAACFTRNAFKAAPVVVSEEVLQRSASTARALVVNSGCANAVTGKQGMEDAWAMVRATDALLGHSAKESETLVMSTGVIGQTLPICKVLAGIESQSSDSQTKSLGSDFTAWERAAKAFMTTDTFPKLRARTFSIDGREYKMAGMDKGAGMIHPDMGPPRMAGQLHATLLGCIMTDAAVSPRSLQSALTYAVDRSFNSISVDGDMSTNDTIVVLANGSAASDPAAEIDEERDPRTYQIFRDELTTFAADLAQLVVRDGEGATKFVTVSVNGAATYEDAHRIASRISTSALVKTALYGQDANWGRILAATGSVPLSVPIDPTRVSVSFIPTDGSPALPLLVNGEPETVDEARAKEIISVEDLEIEVQLGIGSENAKYWTCDFSYEYVRINGDYRS
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of acetylglutamate from glutamate and acetyl-CoA, and of ornithine by transacetylation between acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterodimer of an alpha and a beta chain. The alpha and beta chains are autoproteolytically processed from a single precursor protein within the mitochondrion. This protein may be expected to contain an N-terminal transit peptide but none has been predicted. Belongs to the ArgJ family.
|
Q7VEF9
|
MSFFQSSKWSLIAGGITAPSGFKASGVSAGLKPSKKLDLALLVTSPNAQCSGTFTQSFVRAKCINLCLERLSKTAGKVRAVLVNSGHANACTGNRGIDDSLIATRALAEKLDLLEEEVLICSTGVIGEPIPMQKLLKGLDPLVMNLSKEGGSDAAKAILTTDLIEKEIAIEGYLGDRLIRIGGMAKGSGMIHPNMATMLGFLTCDAGLPKDVWDAMIDRVVDCSFNAISVDGDTSTNDSFLAFAQGDILDSQHFNELEIGLKLVSTYLAQSIVRDGEGANCLFEVKVKGTSKIAHAQIIARQICSSCLVKTAIHGCDPNWGRILSAAGSTGIPFSLDEVSIWIGSFQVMSNGQPVEFNRKLVIRYMKEIIKGNNASDEKLIISLVVGRSEIEAIAWGCDLSSEYIHINADYTT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q7V436
|
MALVEDVFSLSPKAVSSALASLWRPIQGGVSAPLGFQAAGITAGLKDSGKPDLALLLAPEGAVCAGMFTTSLVRAACVDLCVDHLQACGGKARAVLINSGQANACTGERGWLDSLRASQALAGRLELPVEQVLICSTGVIGVPIPMDTLLAGLDPLVEALSDEGGAEAAGAILTTDLVEKQFALEAELGGRSVRIGGMAKGSGMIHPDMATMLGYLSCDVGVEVDAWQAMLKRVVDCSFNAMTVDGDTSTNDSCLAFAAGELLEQEHLQALEAGLLVAAQQLAKAIARDGEGATCLLEVQVEGVVGDVEARRIARTVCGSSLVKTAVHGRDPNWGRIVAAAGCAGVPFDPAAVALWLGPHQLMEFGEPLPFDRLAASRYMQERVDGSYLCDDTVQIRLVVGDGSGDGMAWGCDLSDQYVRINADYTT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q7V3M5
|
MSDGEEKPDGFSFAGIAAGLKDSNKKDLALILAPENSICSGLFTQSIVRASCVDICEQRIKKSSGLIRAILINSGQANACTGDYGIQHTLFATKEVSQLLGINEEEVLMCSTGVIGIPIQIKNLIDNLPNLVKELKTNSLQNAAEAILTTDLVDKKITIETFIEGRKVKISGFAKGSGMIYPNMATMLAFLTCDVGVDKEEWDKMISIAVKKSFNAISVDGETSTNDAFIGINSGKKIDKKFLSKIQSGIDIVCQSLAKNIARDGEGANCLLEVLVEGAKSNSDAIKIAKSICNSSLVKTAINGCDPNWGRIISAAGNSGIDFKLDFLDLYIGDFQILKKGKLNKYDSKKVANYMQTRMNGKYLVEDIVSISLHLNSGSEKGTAWGCDLSKKYVEINSEYTT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q46I07
|
MKNALLNLSLLTSSVWSPISGGITAPDGFLAAGISAGLKPSGKKDLALLYAPDGACCSGTFTQSVTRAYCVDLCIDRIKASEGKIRAVVINSGHANACTGSRGKIDSEMITHKLAQLLRLSSEEVLICSTGVIGEAIPVEKVNSHLDQLINSLDKEAYLDAANAILTTDLQVKQIAYQAVLGGRRISIGGMAKGSGMIHPSMATMLSYLTCDVGVDHVLWSDMIKRVAESSFNSITVDGDTSTNDTFLAFASGAELDPRYLSILEEGLHLTAQHLAKSIARDGEGANCLLEIKVEGASSDLDARAIARTIASSSLVKTAVHGSDPNWGRIIAALGRAGTSFNLNDVKLWIGPYEIFSNGTPLDFDRQIVSNFMKARLTGKYLIDDLISIRLRIGIGTGSATAWGCDLSDQYVRINADYTT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q48EG7
|
MAVGLGPLPALHPVPGFELGISSAGIKRPGRKDVVVMRCAEGSSVAGVFTLNAFCAAPVILAKQRVQGTVRYLLTNTGNANAGTGEPGLVAARRTCEKLAQLTGVDASAVLPYSTGVIGEPLPVEKIEGALQAALDDLSVDNWAAAATGIMTTDTLPKGASRQFTHDGVTITVTGISKGAGMIRPNMATMLGYIATDAKVSQSVLQDLIRDGANKSFNRITIDGDTSTNDCCMLIATGQADLPEITEAKGPLFDALKKAVFDVCMDVAQAIVRDGEGATKFVTVEVNGGGNQQECLDVGYAVAHSPLIKTALFASDPNWGRILAAVGRAGVPDLDVSKIDVFLGGVCIASQGCRATTYTEEQGSAVMAEEEITIRIELGRGDCSETIWTTDLSHEYVKINAEYRT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q9HW04
|
MAVGLGPLSTLHPVPGFELGIASAGIKRPGRKDVVVMRCAEGSSVAGVFTLNAFCAAPVTLAKQRFLGEVRYLLTNTGNANAGTGEAGLAAAAQTCAKLAELAGVAETSVLPYSTGVIGEPLPVAKIEAALPAALADLAEDRWAEAAAGIMTTDTLPKGASRQFVHDGVTVTVTGISKGAGMIKPNMATMLGYIATDAKVAQGVLQDLLRDAANKSFNRITIDGDTSTNDCCMLIATGRAALPEVTQASGALFAALKQAVLEVSMELAQAIVRDGEGATKFVTVQVNGGATHQECLDVGYAVAHSPLIKTALFASDPNWGRILAAVGRAGVANLDVSKIDVFLGDVCIASRGGRAASYTEEQGAAVMAQAEIGIRIELGRGTCSETIWTTDLSHEYVKINAEYRT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q4K7C2
|
MAVGLGPLPTLHPVAGFELGIASAGIKRPGRKDVVVMRCAEGSTVAGVFTLNAFCAAPVILAKQRVQGPVRYLLTNTGNANAGTGEPGLAAASRTCAKLAELTGVDASAVLPYSTGVIGEPLPVEKIEGALQAALDDLSVDNWAAAATGIMTTDTLPKGASRQFQHDGVTITVTGISKGAGMIRPNMATMLGYIATDAKVSREVLQNLLLDGANKSFNRITIDGDTSTNDCCMLIATGQAKLPEITKAEGPLFAALKQAVFEVCMEVAQAIVRDGEGATKFVTVEVNGGATYQECLDVGYTVAHSPLIKTALFASDPNWGRILAAVGRAGVPDLDVSKIDVFLGEVCIASRGARAASYTEAQGAAVMQQEEITIRIELGRGACSETIWTTDLSHEYVKINAEYRT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q3K7U0
|
MAVGLGPLPTLHPVAGFELGIASAGIKRPGRKDVVVMRCAEGSTVAGVFTLNAFCAAPVILAKKRVQNAVRYLLTNTGNANAGTGEPGLAAAERTTAKLAELTGVDASQILPYSTGVIGEPLPVEKIEGALQAALDDLSENNWEAAATGIMTTDTLPKGASRQFQHDGVTITVTGISKGAGMIRPNMATMLGYIATDAKVSRDVLQNLMLDGANKSFNRITIDGDTSTNDCCMLIATGKAALPEINRAEGELFAKLKQAVFEVCMDVAQAIVRDGEGATKFVTVEVNGGGNHQECLDVGYTVAHSPLIKTALFASDPNWGRILAAVGRAGVPDLDVSKIDVFLGEVCIASRGARAATYTEAQGSAVMQQEEITIRIELGRGDCSETIWTTDLSHEYVKINAEYRT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
P59612
|
MAVGLGPLPTLHPVPGFELGIASAGIKRPGRKDVVVMRCAEGSSVAGVFTLNAFCAAPVILSKQRVQGTVRYLLTNTGNANAGTGAPGLAAAERTCAKLAELAGVPAESVLPFSTGVIGEPLPVEKIEGALQAALDNLSENNWAEAATGIMTTDTLPKGASRQFQHDGVTVTVTGISKGAGMIRPNMATMLGYIATDAKVAPKVLKDLMLDGANKSFNRITIDGDTSTNDCCMLIATGKADLPEVTEASGALFEALKKAVFEVCMEVAQAIVRDGEGATKFVTVQVNGGGNHQECLDVGYAVAHSPLIKTALFASDPNWGRILAAVGRAGVPELDVSLIDVYLDSVCIASKGGRSPSYTEAQGSAVMAQEEITIRIELGRGQCSETIWTTDLSHEYVKINAEYRT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
Q87WZ4
|
MAVGLGPLPALHPVPGFELGISSAGIKRPGRKDVVVMRCAEGSSVAGVFTLNAFCAAPVILAKQRVQGTVRYLLTNTGNANAGTGEPGLVAARRTCEALAQLTGVDASAVLPYSTGVIGEPLPVEKIEGALQAALDDLSVDNWAAAATGIMTTDTLPKGASRQFTHDGVTITVTGISKGAGMIRPNMATMLGYIATDAKVSQSVLQDLIRDGANKSFNRLTIDGDTSTNDCCMLIATGQADLPEITEAKGLLFEALKKAVFDVCMEVAQAIVRDGEGATKFVTVEVNGGGNHQECLDVGYAVAHSPLIKTALFASDPNWGRILAAVGRAGVPDLDVSKIDVFLGGVCIASQGCRATTYTEEQGSAVMAEAEITIRIELGRGDCSETIWTTDLSHEYVKINAEYRT
|
Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate. L-glutamate + N(2)-acetyl-L-ornithine = L-ornithine + N-acetyl-L-glutamate acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate Amino-acid biosynthesis; L-arginine biosynthesis; L-ornithine and N-acetyl-L-glutamate from L-glutamate and N(2)-acetyl-L-ornithine (cyclic): step 1/1. Amino-acid biosynthesis; L-arginine biosynthesis; N(2)-acetyl-L-ornithine from L-glutamate: step 1/4. Heterotetramer of two alpha and two beta chains. Some bacteria possess a monofunctional ArgJ, i.e. capable of catalyzing only the fifth step of the arginine biosynthetic pathway. Belongs to the ArgJ family.
|
A9R4J7
|
MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENLFGQPLLVRTVPPRPTEQGQKLLALLHQVELLEEEWLGNDNGVDTPLLLSLAVNADSLATWLLPALKPVLADLPIRLNLQVEDETRTQERLRRGEVVGAVSIQPQPLPSCLVDQLGALDYLFVASKAFAERYFPNGVTRSALLKAPAVAFDHLDDMHQAFLQQNFDLSPGSVPCHIVNSSEAFVQLARQGTTCCMIPHLQIEKELASGELIDLTPGLLQRRMLFWHRFAPESRTMRKVTDALLSYGRQVLRQDSFIGQ
|
Controls the transcription of genes involved in arginine and lysine metabolism. Homodimer. Belongs to the LysR transcriptional regulatory family.
|
C4GXF6
|
MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENLFGQPLLVRTVPPRPTEQGQKLLALLHQVELLEEEWLGNDNGVDTPLLLSLAVNADSLATWLLPALKPVLADLPIRLNLQVEDETRTQERLRRGEVVGAVSIQPQPLPSCLVDQLGALDYLFVASKAFAERYFPNGVTRSALLKAPAVAFDHLDDMHQAFLQQNFDLSPGSVPCHIVNSSEAFVQLARQGTTCCMIPHLQIEKELASGELIDLTPGLLQRRMLFWHRFAPESRTMRKVTDALLSYGRQVLRQDSFIGQ
|
Controls the transcription of genes involved in arginine and lysine metabolism. Homodimer. Belongs to the LysR transcriptional regulatory family.
|
A4TI95
|
MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENLFGQPLLVRTVPPRPTEQGQKLLALLHQVELLEEEWLGNDNGVDTPLLLSLAVNADSLATWLLPALKPVLADLPIRLNLQVEDETRTQERLRRGEVVGAVSIQPQPLPSCLVDQLGALDYLFVASKAFAERYFPNGVTRSALLKAPAVAFDHLDDMHQAFLQQNFDLSPGSVPCHIVNSSEAFVQLARQGTTCCMIPHLQIEKELASGELIDLTPGLLQRRMLFWHRFAPESRTMRKVTDALLSYGRQVLRQDSFIGQ
|
Controls the transcription of genes involved in arginine and lysine metabolism. Homodimer. Belongs to the LysR transcriptional regulatory family.
|
Q666Q6
|
MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENLFGQPLLVRTVPPRPTEQGQKLLALLHQVELLEEEWLGNDNGVDTPLLLSLAVNADSLATWLLPALKPVLADLPIRLNLQVEDETRTQERLRRGEVVGAVSIQPQPLPSCLVDQLGALDYLFVASKAFAERYFPNGVTRSALLKAPAVAFDHLDDMHQAFLQQNFDLSPGSVPCHIVNSSEAFVQLARQGTTCCMIPHLQIEKELASGELIDLTPGLLQRRMLFWHRFAPESRTMRKVTDALLSYGRQVLRQDSFIGQ
|
Controls the transcription of genes involved in arginine and lysine metabolism. Homodimer. Belongs to the LysR transcriptional regulatory family.
|
B1JNR6
|
MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENLFGQPLLVRTVPPRPTEQGQKLLALLHQVELLEEEWLGNDNGVDTPLLLSLAVNADSLATWLLPALKPVLADLPIRLNLQVEDETRTQERLRRGEVVGAVSIQPQPLPSCLVDQLGALDYLFVASKAFAERYFPNGVTRSALLKAPAVAFDHLDDMHQAFLQQNFDLSPGSVPCHIVNSSEAFVQLARQGTTCCMIPHLQIEKELASGELIDLTPGLLQRRMLFWHRFAPESRTMRKVTDALLSYGRQVLRQDSFIGQ
|
Controls the transcription of genes involved in arginine and lysine metabolism. Homodimer. Belongs to the LysR transcriptional regulatory family.
|
Q5GQ85
|
MALIILLVACLSVVSADDCSGKTDAWTSIKGPKTGGYWLKQTTKTGENECTYVKGTDFKENTKTATYTYGYKDASGKLTKTTGTATAKGSDIVVGSDTSTVIYTDGKTCDVVKHGGHTELWVHSSKTSGGYNNCCDKKFTETRGSTPANEVYKKCPGMP
|
Not glycosylated. Causes an allergic reaction in human. Binds to IgE. Major allergen responsible for anaphylactic reactions. Belongs to the calycin superfamily. Histamine-binding salivary protein family.
|
Q73E88
|
MKKEKRQRLIKQFVKEYEIEKQERLVELLAKKDVLVTQATVSRDIRELNVTKVPSQEGLMIYKIFSEEHLQTDIKLKKKLREVVVKIDCVDQLMVIKTLPGNAHVIGVLFDELDWKEKIGCICGNDTCLIISQSKSDREILEERLNLII
|
Regulates the transcription of the arc operon, involved in arginine catabolism. Amino-acid degradation; L-arginine degradation via ADI pathway. Belongs to the ArgR family.
|
Q81II2
|
MKKEKRQRLIKQFVKEYEIDKQERLVELLAKKDVLVTQATVSRDIRELNLTKVPSQEGLMIYKVFSEEHLQTDIKLKKKLREVVVKIDCVDQLMVIKTLPGNAHVIGVLFDELDWKEKIGCICGNDTCLIISQSKSDREIIEERLNLII
|
Regulates the transcription of the arc operon, involved in arginine catabolism. Amino-acid degradation; L-arginine degradation via ADI pathway. Belongs to the ArgR family.
|
Q6HP30
|
MKKEKRQRLIKQFVKEYEIEKQERLVELLAKKDVLVTQATVSRDIRELNLTKVPSQEGLMIYKIFSEEHLQTDIKLKKKLREVVVKIDCVEQLMVIKTLPGNAHVIGVLFDELDWKEKIGCICGNDTCLIISQSKSDREILEERLNLII
|
Regulates the transcription of the arc operon, involved in arginine catabolism. Amino-acid degradation; L-arginine degradation via ADI pathway. Belongs to the ArgR family.
|
Q46172
|
MSNLEKSLRHEVILDIIESKCICKQEELIIELKECGINVTQATLSRDLHEMNIIRKSFENHEHRYIVTKEDKFIKKFKNIFKSSVRSISMQEYFISVNTLDGMASLIGEFIDRLGDGRIAGTVAKKNHILVLCRSVNATQQIFKELDSLRV
|
Regulates the transcription of the arc operon, involved in arginine catabolism. Amino-acid degradation; L-arginine degradation via ADI pathway. Belongs to the ArgR family.
|
F9UNG2
|
MKKSERQAVIEQLISEYPIATQEELMAKLKAEGIAATQATISRDIREMQIVKTPDEHGQTRYAIFKTTNKNEQDRLFETLHDVVTSIDRVEFMNIIHTLPSNGNLLAAIIDDLNLPEVSGTLAGHDTIFVVSPNTTVAKQLYESFASHISNED
|
Regulates the transcription of the arc operon, involved in arginine catabolism. Amino-acid degradation; L-arginine degradation via ADI pathway. Belongs to the ArgR family.
|
Q48XN0
|
MNKKETRHQLIRSLISETTIHTQQELQERLQKNGITITQATLSRDMKELNLVKVTSGNDTHYEALAISQTRWEHRLRFYMEDALVMLKIVQHQIILKTLPGLAQSFGSILDAMQIPEIVATVCGDDTCLIVCEDNEQAKACYETLSHYTPPFFFSNK
|
Regulates the transcription of the arc operon, involved in arginine catabolism. Amino-acid degradation; L-arginine degradation via ADI pathway. Belongs to the ArgR family.
|
Q879A7
|
MNKKETRHRLIRSLISETTIHTQQELQERLQKNGITITQATLSRDMKELNLVKVTSGNDTHYEALAISQTRWEHRLRFYMEDALVMLKIVQHQIILKTLPGLAQSFGSILDAMQIPEIVATVCGDDTCLIVCEDNEQAKACYETLSHYTPPFFFSNK
|
Regulates the transcription of the arc operon, involved in arginine catabolism. Amino-acid degradation; L-arginine degradation via ADI pathway. Belongs to the ArgR family.
|
Q5XAY0
|
MNKKETRHQLIRSLISETTIHTQQELQERLQKNGITITQATLSRDMKELNLVKVTSGNDTHYEALAISQTRWEHRLRFYMEDALVMLKIVQHQIILKTLPGLAQSFGSILDAMQIPEIVATVCGDDTCLIVCEDNEQAKACYETLSHYTPPFFFSNK
|
Regulates the transcription of the arc operon, involved in arginine catabolism. Amino-acid degradation; L-arginine degradation via ADI pathway. Belongs to the ArgR family.
|
D6VZL7
|
MTSNSDGSSTSPVEKPITGDVETNEPTKPIRRLSTPSPEQDQEGDFDEEDDDDKFSVSTSTPTPTITKTKDSSDTSTVTRRKQPIRYIENKTRRHVTFSKRRHGIMKKAYELSVLTGANILLLILANSGLVYTFTTPKLEPVVREDEGKSLIRACINASDTPDATDTSPAQEQSPAN
|
With ARG81, ARG82 and MCM1, coordinates the expression of arginine anabolic and catabolic genes in response to arginine. Interacts with ARG81 and ARG82.
|
Q731B9
|
MNKGQRHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYKYSLPADQRFNPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIICRTPEDTGVVSDRFLNML
|
Regulates arginine biosynthesis genes. Amino-acid biosynthesis; L-arginine biosynthesis [regulation]. Belongs to the ArgR family.
|
Q818S1
|
MNKGQRHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYKYSLPADQRFNPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIICRTPDDTGVVSDRFLNML
|
Regulates arginine biosynthesis genes. Amino-acid biosynthesis; L-arginine biosynthesis [regulation]. Belongs to the ArgR family.
|
Q6HDZ0
|
MNKGQRHIKIREIIANKEIETQDELVDILRNEGFNVTQATVSRDIKELHLVKVPLHDGRYKYSLPADQRFNPLQKLKRNLVDSFVKLDTAGHMLVLKTLPGNAHSLGALIDHLEWDEIIGTICGDDTCLIICRTPEDTGVVSDRFLNML
|
Regulates arginine biosynthesis genes. Amino-acid biosynthesis; L-arginine biosynthesis [regulation]. Belongs to the ArgR family.
|
P58685
|
MKSKRHSKIIEIIKSTAIETQEELAEELKKAGFDVTQATVSRDIKNLKLVKKQDNKGHYRYTIIEEEKNEMVDRLSNILANTVTSVENVDKMVVVKTISGSASAAAEAIDTLHLGEIAGTIAGGNTIFILVRSLEKAETLVSRILEMIEG
|
Regulates arginine biosynthesis genes. Amino-acid biosynthesis; L-arginine biosynthesis [regulation]. Belongs to the ArgR family.
|
Q2FGL3
|
MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDEIKSRIFNLL
|
Regulates arginine biosynthesis genes. Amino-acid biosynthesis; L-arginine biosynthesis [regulation]. Belongs to the ArgR family.
|
Q2FY49
|
MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDEIKSRIFNLL
|
Regulates arginine biosynthesis genes. Amino-acid biosynthesis; L-arginine biosynthesis [regulation]. Belongs to the ArgR family.
|
A5IT49
|
MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDEIKSRIFNLL
|
Regulates arginine biosynthesis genes. Amino-acid biosynthesis; L-arginine biosynthesis [regulation]. Belongs to the ArgR family.
|
Q2YYC1
|
MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDEIKSRIFNLL
|
Regulates arginine biosynthesis genes. Amino-acid biosynthesis; L-arginine biosynthesis [regulation]. Belongs to the ArgR family.
|
Q5HFQ1
|
MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDEIKSRIFNLL
|
Regulates arginine biosynthesis genes. Amino-acid biosynthesis; L-arginine biosynthesis [regulation]. Belongs to the ArgR family.
|
A6QH66
|
MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDEIKSRIFNLL
|
Regulates arginine biosynthesis genes. Amino-acid biosynthesis; L-arginine biosynthesis [regulation]. Belongs to the ArgR family.
|
Q99TX3
|
MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDEIKSRIFNLL
|
Regulates arginine biosynthesis genes. Amino-acid biosynthesis; L-arginine biosynthesis [regulation]. Belongs to the ArgR family.
|
Q6GGH8
|
MPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVSRDIKELQLIKVPIPSGQYVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGNAQSIGAILDQINWEEVLGTICGDDTCLIICRSKEASDEIKSRIFNLL
|
Regulates arginine biosynthesis genes. Amino-acid biosynthesis; L-arginine biosynthesis [regulation]. Belongs to the ArgR family.
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.