UniProt ID
stringlengths 6
10
| Protein Sequence
stringlengths 2
35.2k
| Functional Description
stringlengths 5
30.7k
|
|---|---|---|
Q6C7W8
|
MISPNLTANVEIDGKQYNTFTEPPKALAGERAKVKFPIKDMTEFLHGGEENVTMIERLMTELERDPVLNVSGDYDMPKEQLRETAVARIAALSGHWKKDTEKEALLRSQLHGIVDMGTRIRLGVHTGLFMGAIRGSGTKEQYDYWVRKGAADVKGFYGCFAMTELGHGSNVAGLETTATYIQDTDEFIINTPNTGATKWWIGGAAHSATHTACFARLLVDGKDYGVKIFVVQLRDVSSHSLMPGIALGDIGKKMGRDAIDNGWIQFTNVRIPRQNMLMKYAKVSSTGKVSQPPLAQLTYGALIGGRVTMIADSFFVSQRFITIALRYACVRRQFGTTPGQPETKIIDYPYHQRRLLPLLAFTYAMKMAADQSQIQYDQTTDLLQTIDPKDKGALGKAIVDLKELFASSAGLKAFTTWTCANIIDQCRQACGGHGYSGYNGFGQAYADWVVQCTWEGDNNVLCLSMGRGLIQSCLGHRKGKPLGSSVGYLANKGLEQATLSGRDLKDPKVLIEAWEKVANGAIQRATDKFVELTKGGLSPDQAFEELSQQRFQCAKIHTRKHLVTAFYERINASAKADVKPYLINLANLFTLWSIEEDSGLFLREGFLQPKDIDQVTELVNHYCKEVRDQVAGYTDAFGLSDWFINAPIGNYDGDVYKHYFAKVNQQNPAQNPRPPYYESTLRPFLFREDEDDDICELDEE
|
Oxidizes aliphatic acyl-CoA substrates of different chain lengths such as hexanoyl-CoA, decanoyl-CoA and myristoyl-CoA as well as aromatic/heterocyclic ring-substituted chromogenic substrates, such as furylpropionyl-CoA. Of the above substrates, the efficiency of the enzyme, exhibits the following order: decanoyl-CoA > myristoyl-CoA > hexanoyl-CoA > furyl-propionyl-CoA. a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2 Optimum pH is 7.4. Optimum temperature is 23-38 degrees Celsius. Lipid metabolism; peroxisomal fatty acid beta-oxidation. Heteropentamer composed of five different subunits. Belongs to the acyl-CoA oxidase family.
|
Q7WH64
|
MSSVSAAGATPPASPGCIAGIGMDLLRIERIERALARHGDRFAQKILGPEELAKFHARRRRDPARGVRFLATRFAAKEAFSKAIGLGMRMPMSWRRVQTLNAPGGRPVLVIGAELADWFDARFGAAHVSITDESDMAAAYVIVERKPAPDGRP
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
O51043
|
MKSIGCDIIKVERFKNFLENKKKMERFFTHKEIENFKLKGGSIIESLAGKFAAKESLIKALSPLLQYKINYTLKDIEVIKSLKGNAEFCLHNEVEKFAIKMNLKLYLTISHEKEYAIAFVIVEN
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B7J0U9
|
MKSIGCDIIKVERFKNFLENKKKMERFFTHKEIENFKLKGGSIIESLAGKFAAKESLIKALSPLLQYKINYTLKDIEVIKSLKGNAEFCLHNEVEKFAIKMNLKLYLTISHEKEYAIAFVIVEN
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q663A2
|
MKSIGCDIIKVGRFKNFLENKKKLERFFTHKEIENFKLKGGSVIESLAGKFAAKESLIKALSPLLQHKIHYGLKDIEVIKSLKGNAKFYLHNEIEKFAIKMNLKIYLTISHEKEYAIAFVMVEN
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B2S1J9
|
MTKSIGCDIIKVTRFNSFLQNRKKLDRFFTQREIENLEMKGKGILESLAGKFSAKEALIKALSPLINTKIKYSLKDIEIIALPKGNIIFQLHNDIKVLIEQMDLKLYLTISHEREYAIAFVIVED
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q7W9J6
|
MSSVSAAGATPPASPGCIAGIGMDLLRIERIERALARHGDRFAQKILGPEELAKFHARRRRDPARGVRFLATRFAAKEAFSKAIGLGMRMPMSWRRVQTLNALGGRPVLVIGAELADWFDARFGAAHVSITDESDMAAAYVIVERKPAPDGRP
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q7VWV9
|
MSSVSAAGATPPASPGCIAGIGMDLLRIERIERALARHGDRFAQKILGPKELAKFQARRRRDPARGVRFLATRFAAKEAFSKAIGLGMRMPMSWRRVQTLNAPGGRPVLVIGAELADWFDARFGAAHVSITDESDMAAAYVIVERKPAPDGRP
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
A1QYG3
|
MTKSIGCDIIKVTRFNSFLQNRKKLERFFTQREIENSAMKGKGVLESLAGKFSAKESLIKALSPLINIKIKYSLKDIEIISLPKGNIIFQLHNDIKTLINQMNLKLYLTISHEREYAIAFVIVEN
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
O69159
|
MIIGIGSDLIDITRVGKVIERHGERFLDRIFTAAERAKAERRAKNEKMVVATYAKRFAAKEACSKALGTGIRRGVWWRDMGVVNLPGGRPTMQLTGGALARLQALTPDGFEARIDVSITDDWPLAQAFVIISAVPLAKS
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
A5EKL9
|
MIIGIGSDLIDIRRVAEVIERHGDRFLNRIFTEAERAKAERRAKNEKMVVATYAKRFAAKEACSKALGTGIRHGVWWRDMGVVNLPGGRPTMQLTGGAAERLKALTPAGHDARIDLSITDDWPLAQAFVIISAVSLATS
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
C0ZK19
|
MIIGTGVDIVEIERIATLIKRQERAIKHFLTTDEQQLLHGKSETRQAEMVAGRFAAKEAGAKALGTGIGAVLSFLDMEILPNHLGKPVMTIKNEVYSKLDLDPTRVHIHVSISHSQSHAIAQVIVEER
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B2SAD7
|
MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTEIEQRKSEGRKQRAASYAKRFAAKEACAKALGTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLLPAGTNAAIHLTITDDFPLAQAFVIIEALPVLE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q2YN04
|
MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTEIEQRKSEGRKQRAASYAKRFAAKEACAKALGTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLLPAGTNAAIHLTITDDFPLAQAFVIIEALPVLE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q57E83
|
MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTEIEQRKSEGRKQRAASYAKRFAAKEACAKALGTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLLPAGTNAAIHLTITDDFPLAQAFVIIEALPVLE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
A9MA33
|
MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTEIEQRKSEGRKQRAASYAKRFAAKEACAKALGTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLLPAGTNAAIHLTITDDFPLAQAFVIIEALPVLE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
C0RI01
|
MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTEIEQRKSEGRKQRAASYAKRFAAKEACAKALGTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLLPAGTNAAIHLTITDDFPLAQAFVIIEALPVLE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q8YG72
|
MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTEIEQRKSEGRKQRAASYAKRFAAKEACAKALGTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLLPAGTNAAIHLTITDDFPLAQAFVIIEALPVLE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
A5VPJ6
|
MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTEIEQRKSEGRKQRAASYAKRFAAKEACAKALGTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLLPAGTNAAIHLTITDDFPLAQAFVIIEALPVLE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B0CKY5
|
MIVGIGSDLIDIRRVEKTLERHGSRFRDRVFTEIEQRKSEGRKQRAASYAKRFAAKEACAKALGTGIAEGVFWRDMGVVNTPSGKPTMHLTGGAAKQLQKLLPAGTNAAIHLTITDDFPLAQAFVIIEALPVLE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
A9KLF9
|
MIFGIGTDMIEINRVVKACERKTFLTKIYTEQEQKLLLSDIRKAASNFAVKEAVVKMFGTGFRAIAPNEIEVLRDNLGKPYVNLYGNAEILAKEHNVERIHVSITNTKELVSAYVIGEIIRE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
F9UKZ7
|
MIYGTGIDLTELSRIEAILAKGLRLPEKILTPAELAVFSRYPVKRQIEFMAGRFSAKEAYSKAYGTGIGAAVGFQDIEILDNAQGKPEVTRHPFDGPAWISISHTDTLVMTQVILERGNL
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
C1D7L8
|
MIVGIGTDLAEVARFEQLLARHGQRVARRMLAAAELDEFARAADPARFLAKRFAAKEAFAKAAGTGVRAPVLLPAIAVTHDELGKPAFACSAVLHDWLTARGVQRMHVSISDERTHCLAFVVFEG
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q38V63
|
MIVGLGIDLAEIDRFEKAQEKNSRFAEKVLTATEFELFSHYTGRRALEFLAGRFAVKEAFSKAYGTGIGQVKLQAVETLNDPQGKPYIKQDLFDGVVHVSLSHTATLVIAEVILERG
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q6AD33
|
MIAGIGVDVVDLARFGRSLARTPALRDRLFTEAERGLPVHSLAARFAAKEALIKALGGSEGVRWHDLEIVSDEERNPAFVLRNVVERQALERGIAHIHVSMSHDAGIATAFVVLERDS
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B0SE17
|
MLSVGNDIVENERIRELLQKHGDRFLKRVFTDDEVEYCHKHKDPVPFLAGRFACKEAVIKALNLEPGQVADMREIELAGTNFGKKTLVIHGKTEKFFREKGFTGSSVSISHADHYSTAVVVFFKEPK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q04U76
|
MKISVGNDIVENARIRDLLEKHGDRFLKRIFSESEREYCSNRKDPVPHLSGRFCVKEAFIKAIEPKVVLDMREIELFGKEFGKKELVLHGKSKELFLTKGYNGCSVSISHAENYSTAVVVLYKE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q053N9
|
MKISVGNDIVENARIRDLLEKHGDRFLKRIFSESEREYCSNRKDPVPHLSGRFCVKEAFIKAIEPKVVLDMREIELFGKEFGKKELVLHGKSKELFLTKGYNGCSVSISHAENYSTAVVVLYKE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B0SM94
|
MLSVGNDIVENERIRELLQKHGDRFLKRVFTDDEVEYCHKHKDPVPFLAGRFACKEAVIKALNLEPGQVADMREIELAGTNFGKKTLVIHGKTEKFFREKGFTGSSVSISHADHYSTAVVVFFKEPK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B1XZM3
|
MIYGVGTDICDIRRIAATLQRRGDRFAERVLGPREIEVFRYRRAKVEARGLSYLATRFSAKEAFSKAIGLGLHQPMSWRSCEILNAPSGQPQIHLHGALADWFAQRRLIAHVSLTDETDYATSFVVVETQGL
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q72U18
|
MKISVGNDIVENSRIRDLLEKHGDRFLKRVFSESEREYCSNRKDPIPHLSGRFCVKEAFIKAIEPGDHVILDMREIELFGKEFGKKELVLHGKSKELFLTKGYSGCSVSISHAENYSTAVVVLYKE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q8F136
|
MKISVGNDIVENSRIRDLLEKHGDRFLKRVFSESEREYCSNRKDPIPHLSGRFCVKEAFIKAIEPGDHVILDMREIELFGKEFGKKELVLHGKSKELFLTKGYSGCSVSISHAENYSTAVVVLYKE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B1MX05
|
MIIGIGNDTEAISRVGQIVARQTKFMDSILTPAEREQALERKGKHFHEFVAGRFSAKEAFSKATGYGIGEKVHWHDIEILNEPNGRPIMQVKNFRYKTYVAITHSGDFVNTVVIIERLTILERLSLKFFPKRGVL
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q03V72
|
MIIGIGNDTEAISRVAEIVERQKSFITLILTPAERAAAAERKGKHQNEYIAGRFSAKEAFSKATGYGIGEKVQWQDIEILNEPNGRPVMKVKNFPYHTYVAITHSGDQVNTVVVIERLTLLEKMSIKLFPKRGVLS
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q03T07
|
MIYGTGIDITDLKRVQRVVERQPRFLTKVLTPNERVDYQKLSGQRALEFIAGRWSAKESYSKAMGTGIGATVTFQDIEIRDNDAGRPVVRRQPFGGIAHVSISHTETVVMTQVILERGNESW
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q1WV15
|
MIYGNGIDIQEIRKIQKAQEKRESFAKRILTVNELAIFEKYKGNRKYEFLAGRFSAKEAFSKAYGTGIGKKVGFQDIEILNDNQTGRPEIVKFPGDNKLQAKISISHSGEYVVTEVILEKLTWQTKMKKFLIKQK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B2GA64
|
MIAGIGIDVAEIDRIKRAVEKTPSFINKVLTKGEQAQLATLKNQRYYEYIAGRFSLKEAYSKALGTGIGRHVSFLDVEIIDNELGQPVVVSHPFDGPAHASVSHTGQLVFTEVILEKGE
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
A5VI50
|
MIKGIGIDITEIERVKKAATAHSQFIQHVLTPTELEQYSQFSGQRSVEYLAGRWSLKESFAKAYGTGIGANLGFHDIEIIDNQYGAPIVTKSPYNGNAHASVSHTATLVMTEVILESENK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B2G5M8
|
MIKGIGIDITEIERVKKAATAHSQFIQHVLTPTELEQYSQFSGQRSVEYLAGRWSLKESFAKAYGTGIGANLGFHDIEIIDNQYGAPIVTKSPYNGNAHASVSHTATLVMTEVILESENK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q9FCV3
|
MIYGIGIDITNIDRFKALHNPTSFIKKVLTDKEQAELAGKSGQRAYEFLAGHFSVKESYSKAYGTGLGKKLNFQDIEVEYDDNGRPVISNHPFAGVAHVSISHSKHHVVTQVILEGD
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q8E3M8
|
MIVGHGIDLQEIEAITKAYERNQRFAERVLTEQELLLFKGISNPKRQMSFLTGRWAAKEAYSKALGTGIGKVNFHDIEILSDDKGAPLITKEPFNGKSFVSISHSGNYAQASVILEEEK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q82DL2
|
MSIIGVGIDVAEIDRFRASLERTPGLADRLFLERELLLPNGERRGIASLAARFAAKEAVAKALGAPGGLYWTDAEVWVEDSGRPRLRVTGTVAARAAELGVQSWHVSLSHDAGVASAVVVAEG
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
O86785
|
MSIIGVGIDVAEVERFGAALERTPALAGRLFLESELLLPGGERRGVASLAARFAAKEALAKALGAPAGLLWTDAEVWVEAGGRPRLRVTGTVAARAAELGVASWHVSLSHDAGIASAVVIAEG
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
C0M6I4
|
MIVGHGIDLQDISAIEKVYLRNARFARKVLTDKELALFEQFSHHRKMTYLAGRWAGKEAFSKAMGTGIGQLTFQDIEIINDSKGRPVITKSPFQGKAFISISHSGGYVQASVILEDLA
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B4U177
|
MIVGHGIDLQDISAIEKVYLRNARFARKVLTDKELALFEQFSHNRKMTYLAGRWAGKEAFSKAMGTGIGQLTFQDIEIINDSKGRPVITKSPFQGKAFISISHSGGYVQASVILEDLA
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B1W3W2
|
MIIGVGIDVAEIERFGAALERTPQLADRLFVGSELTLPSGERRGIASLAARFAAKEALAKALGAPGGLLWSDAEVWVEESGQPRLRVSGTVAARAAELGVRGWHVSLSHDAGVASAVVIAEG
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q8DSF3
|
MIIGHGIDLQDIAAVQRAHERSSRFASKVLTFKELEIFTSLKGRRQVEYLAGRWAAKEAFSKAYGSGIGSLRFQDLEILANNKGAPIFTKSPFSGNIFISISHSKNYVEASVILEENNL
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q48WX4
|
MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLNYLAGRWSGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q04J73
|
MIVGHGIDIEELASIESAVTRHEGFAKRVLTAQEMERFTSLKGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVILEENHES
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q8NZK3
|
MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWSGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B5E746
|
MIVGHGIDIEELASIESAVTRHEGFAKRVLTAQEMERFTSLKGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVILEENHES
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q5XAA3
|
MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWSGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
C1C8T7
|
MIVGHGIDIEELASIESAVTRHEGFAKRVLTAQEMERFTSLKGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVILEENHES
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q1JA49
|
MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWSGKEAFVKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q1JK99
|
MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWSGKEAFVKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q1JF93
|
MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWSGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q1J544
|
MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWSGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
A2RCT2
|
MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWSGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
B1I756
|
MIVGHGIDIEELASIESAVTRHEGFAKRVLTAQEMERFTSLKGRRQIEYLAGRWSAKEAFSKAMGTGISKLGFQDLEVLNNERGAPYFSQAPFSGKIWLSISHTDQFVTASVILEENHES
|
Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. apo-[ACP] + CoA = adenosine 3',5'-bisphosphate + H(+) + holo-[ACP] Belongs to the P-Pant transferase superfamily. AcpS family.
|
Q2SXU4
|
MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEAEKITTVQQAIDYARANVKA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q8R9W1
|
MIFEKVRNIIAEQLGIDPEEITMESSFIDDLGADSLDIVELIMALEEEFDIEIPDEDAEKIKTVGDVVEYLSNIVE
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A7ZF37
|
MAVFEDVRDVVVEQLSVDPQAVKLESKIIEDLGADSLDVVELVMALEEKFEVEIPDSEAEKLVSIQDVVNYIEKLGK
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A7GWR1
|
MAVFDDVRDVVVEQLSVDPEAVKMESKIIEDLGADSLDVVELVMALEEKFEVEIPDTEAEKLISIADVVNYIEKLGK
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A0RQM2
|
MAVFDEVKDVVVEQLSVAPDAVKMESKIIEDLGADSLDVVELVMALEEKFEVEIPDSEAEKLISISDVVNYIDGLKK
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A7HZZ5
|
MEVFEEVRDVVVEQLSVAPDAVKIDSKIIEDLGADSLDVVELVMALEEKFGIEIPDSEAEKLISIKDVVTYIENLNKNK
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A8FKM8
|
MATFDDVKAVVVEQLSIDADAVKMESKIIEDLGADSLDVVELIMALEEKFEVEIPDSDAEKLIKIEDVVNYIDNLKK
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A7H4T8
|
MATFDDVKAVVAEQLSIDADAVKMESKIIEDLGADSLDVVELIMALEEKFEVEIPDSDAEKLIKIEDVVNYIDNLKK
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q0PB69
|
MATFDDVKAVVVEQLSIDADAVKMESKIIEDLGADSLDVVELIMALEEKFEVEIPDSDAEKLIKIEDVVNYIDNLKK
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A1VYF9
|
MATFDDVKAVVVEQLSIDADAVKMESKIIEDLGADSLDVVELIMALEEKFEVEIPDSDAEKLIKIEDVVNYIDNLKK
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q5HW23
|
MATFDDVKAVVVEQLSIDADAVKMESKIIEDLGADSLDVVELIMALEEKFEIEIPDSDAEKLIKIEDVVNYIDNLKK
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
B9KF13
|
MAIFDDVKKVVVEQLSVDEDVVKMESKIIEDLGADSLDVVELVMALEEKFDVEIPDSDAEKLVKIEDVVNYIENLQK
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q3AC56
|
MAGVFERVKKIIVDQLGVEEDEVTMEASFIDDLGADSLDIVELIMAFEEEFELEIPDEDAEKIRTVGDAVNYIQERV
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q9A7P3
|
MSDILERVRKIVIEHLDADPEKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAAEHIQTVGDAVKFITEKTA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
B8GVP4
|
MSDILERVRKIVIEHLDADPEKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAAEHIQTVGDAVKFITEKTA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
B3PEV2
|
MSSIEERVKKIVAEQLGVKEEEVKNEASFVEDLGADSLDTVELVMALEEEFETEIPDEEAEKITTVQLAIDYINANLA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A3PIR9
|
MSDIADRVKKIVVEHLGVEEEKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAAETIQTFGDAVKFISEAA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q3J3L2
|
MSDIADRVKKIVVEHLGVEEEKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAAETIQTFGDAVKFISEAA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A4WRF7
|
MSDIADRVKKIVVEHLGVEEEKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAAETIQTFGDAVKFISEAA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
B9KQD1
|
MSDIADRVKKIVVEHLGVEEEKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAAETIQTFGDAVKFISEAA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q7UZQ0
|
MSQEEILQKVCSIVSEQLSVESAEVKSDSNFQNDLGADSLDTVELVMALEEAFDIEIPDEAAEGIATVGDAVKFIEEKKG
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A2BTJ0
|
MSQEILEKVCSIVSEQLSVEAGEVKSDSNFQNDLGADSLDTVELVMALEEAFDIEIPDEAAEGIATVGDAVKFIEEKKG
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q46IK3
|
MSQEAILEKVRSIVAEQLSVEAGEVKPDSNFQNDLGADSLDTVELVMALEEAFDIEIPDEAAEGIATVGDAVKYIEEKQS
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q15TZ9
|
MSDIEERVKKIIIEQLGVKEEEVKSEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQSAIDYVNAHKDA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q1ICY6
|
MSTIEERVKKIVAEQLGVKEEEVKNESSFVDDLGADSLDTVELVMALEEEFETEIPDEEAEKITTVQAAIDYVNAHQG
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
C3K0N3
|
MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEAEKITTVQAAIDYVTSHQA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A4XSS7
|
MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQAEKITTVQEAIDYVTAHAQ
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A5W713
|
MSTIEERVKKIVAEQLGVKEEEVTIEKSFVDDLGADSLDTVELVMALEEEFETEIPDEEAEKITTVQAAIDYVKAHQA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q3K8L1
|
MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEAEKITTVQAAIDYVTSHQA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
B0KF56
|
MSTIEERVKKIVAEQLGVKEDEVTNEKSFVDDLGADSLDTVELVMALEEEFETEIPDEEAEKITTVQAAIDYVNSHKA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q88LL5
|
MSTIEERVKKIVAEQLGVKEEEVTVEKSFVDDLGADSLDTVELVMALEEEFETEIPDEEAEKITTVQAAIDYVKAHQA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
B1J4Z1
|
MSTIEERVKKIVAEQLGVKEDEVTNEKSFVDDLGADSLDTVELVMALEEEFETEIPDEEAEKITTVQAAIDYVNSHQG
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
P80923
|
MSTIEERVKKIVAEQLGVKSEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEAEKITTVQAAIDYVNSHQA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A4VMS0
|
MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQAEKITTVQEAIDYINAHAQ
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A1STW4
|
MSNIEERVRNIIVEQLGVQLEEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQSAIDYVVNNG
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
A9WP63
|
MASNEEILAGLAEIVNEETGLAPEAVELDKSFTDDLDIDSISMMTIVVNAEEKFGVRIPDEEVKNLKTVGDAVSYIASAQA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
B3PUU1
|
MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAADSILTVGDAVKFIEKAQA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q2KA89
|
MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAADSILTVGDAVKFIEKAQA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q1MJ06
|
MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAADSILTVGDAVKFIEKAQA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
Q9RG22
|
MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAADSILTVGDAVKFIEKAQA
|
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Lipid metabolism; fatty acid biosynthesis. 4'-phosphopantetheine is transferred from CoA to a specific serine of apo-ACP by AcpS. This modification is essential for activity because fatty acids are bound in thioester linkage to the sulfhydryl of the prosthetic group. Belongs to the acyl carrier protein (ACP) family.
|
P48182
|
MKKTVKILLILITVFLKVHCNGGHDDEAADFLSHTNIDDPNNSSDPNKNSDQGDTMGEDEDRLVIDLFREYNFLIRPVKNVSSPPVVVDFGVAMILLINVDEKNQILQTNVWLTMKWNDFQLAWNPAEYGNISNLHVPSDRVWLPDIVLFNNADGNYEVSFKSNVFVDHHGDVTWVPPAMFKSSCRIDVEWFPFDEQCCTLVFGSWTYNSEEVRLHWYNNIQAVQLHDYSYSGIWDVIDVPGQLVHKPDLKENKMVFNVVIRRKTLFYTVILIIPTVLMAFLSVMAFYLPVDSGEKVSLTISLLLALVVFLLLVSKILPPTSNIPLMGKYLLLAFVLNITAVVGTVVIVNIYFRSALSHKMPTWVRKVFLEFLPHLLVMKRPERIPIFNGYFVEEYCASEIFDASLVMPSMTATMLPFLQVTTNLKAASSTSSGQSSEHHENCSKWKKRLSIRMSKRRAPRARLDDDSEDIIDDTNGNHVDSLQEKISKEMKTTVEAIAYIAEHMKREMSLKKMRDDWKYVAMVLDRLILLIFFGVTLGGTLGIICSAPHVFDFVDQEAIISKLNAKYLPSDMYS
|
Non-alpha subunit of nicotinic acetylcholine receptor (nAChR) (PubMed:8581398, PubMed:20027209). Acts in cholinergic motoneurons to regulate presynaptic neurotransmitter release, thereby ensuring normal level of excitation of cholinergic motoneurons during locomotion (PubMed:20027209, PubMed:23658528, PubMed:27782882). Component of nicotinic acetylcholine receptor. In cholinergic motoneurons, composed of 2 non-alpha subunits acr-2 and acr-3, and 3 alpha subunits unc-38, unc-63 and acr-12. Specifically expressed in cholinergic ventral cord motoneurons of the VA, VB, DA and DB classes but not AS and VC classes. Expressed in PVQ and DVC neurons in the tail. Expressed from L1 larval stage through adults. Locomotion is slower. Moderately resistant to paralysis induced by acetylcholine esterase inhibitor aldicarb but sensitivity to acetylcholine agonist levamisole is normal. Reduced both cholinergic and GABAergic motoneuron activities characterized by a reduction in miniature postsynaptic currents in muscles. Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily.
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.